KEGG   Physeter catodon (sperm whale): 102986788
Entry
102986788         CDS       T06011                                 

Gene name
CDKN2C
Definition
(RefSeq) cyclin-dependent kinase 4 inhibitor C
  KO
K06622  cyclin-dependent kinase inhibitor 2C
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04110  Cell cycle
pcad04934  Cushing syndrome
pcad05166  Human T-cell leukemia virus 1 infection
pcad05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102986788 (CDKN2C)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    102986788 (CDKN2C)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102986788 (CDKN2C)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102986788 (CDKN2C)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102986788 (CDKN2C)
SSDB
Motif
Pfam: Ank_4 Ank_5 Ank_2 Ank Ank_3 DUF1843
Other DBs
NCBI-GeneID: 102986788
NCBI-ProteinID: XP_007121535
UniProt: A0A2Y9FFC9
LinkDB
Position
4
AA seq 168 aa
MAEPWGNELASAAARGDLEQLTSLLQNNVNVNAQNGFGRTALQVMKLGNPEIARRLLLRG
ANPDLRDRTGFAVIHDAARAGFLDTLQTLLEFQADVNIEDNEGNLPLHLAAKEGHLPVVE
FLVKHTACKVGHRNHQGDTACDLARLYRRNEVVSLMEGNRAEGAANLQ
NT seq 507 nt   +upstreamnt  +downstreamnt
atggccgagccttgggggaacgagttggcgtccgcagctgccaggggggacctagagcaa
cttactagtttgttgcaaaataatgtaaacgtcaatgcacaaaatggatttggaaggact
gcgctgcaggttatgaaacttggaaatcccgagattgccaggagactactacttagaggt
gctaatcccgatttgagagaccgaactggtttcgctgtcattcacgatgcagccagagca
ggtttcctggacactttacagactttgctggagtttcaagctgatgttaacatcgaggat
aatgaagggaacctgcccttgcacttggctgccaaagaaggccacctccccgtggtggag
ttccttgtgaagcacacggcctgcaaagtggggcatcggaaccatcagggggacaccgcc
tgcgacttggccaggctctaccggagaaacgaggtcgttagcctgatggagggaaaccgg
gcggagggagctgcgaatctgcaatga

DBGET integrated database retrieval system