KEGG   Physeter catodon (sperm whale): 102987227
Entry
102987227         CDS       T06011                                 

Gene name
CTNNB1
Definition
(RefSeq) catenin beta-1
  KO
K02105  catenin beta 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04015  Rap1 signaling pathway
pcad04310  Wnt signaling pathway
pcad04390  Hippo signaling pathway
pcad04510  Focal adhesion
pcad04520  Adherens junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04670  Leukocyte transendothelial migration
pcad04916  Melanogenesis
pcad04919  Thyroid hormone signaling pathway
pcad04934  Cushing syndrome
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05100  Bacterial invasion of epithelial cells
pcad05132  Salmonella infection
pcad05160  Hepatitis C
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102987227 (CTNNB1)
   04310 Wnt signaling pathway
    102987227 (CTNNB1)
   04390 Hippo signaling pathway
    102987227 (CTNNB1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102987227 (CTNNB1)
   04520 Adherens junction
    102987227 (CTNNB1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102987227 (CTNNB1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102987227 (CTNNB1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102987227 (CTNNB1)
   04916 Melanogenesis
    102987227 (CTNNB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102987227 (CTNNB1)
   05205 Proteoglycans in cancer
    102987227 (CTNNB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102987227 (CTNNB1)
   05225 Hepatocellular carcinoma
    102987227 (CTNNB1)
   05226 Gastric cancer
    102987227 (CTNNB1)
   05216 Thyroid cancer
    102987227 (CTNNB1)
   05217 Basal cell carcinoma
    102987227 (CTNNB1)
   05215 Prostate cancer
    102987227 (CTNNB1)
   05213 Endometrial cancer
    102987227 (CTNNB1)
   05224 Breast cancer
    102987227 (CTNNB1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102987227 (CTNNB1)
   05022 Pathways of neurodegeneration - multiple diseases
    102987227 (CTNNB1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102987227 (CTNNB1)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102987227 (CTNNB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102987227 (CTNNB1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102987227 (CTNNB1)
   05100 Bacterial invasion of epithelial cells
    102987227 (CTNNB1)
  09172 Infectious disease: viral
   05160 Hepatitis C
    102987227 (CTNNB1)
   05163 Human cytomegalovirus infection
    102987227 (CTNNB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102987227 (CTNNB1)
   05165 Human papillomavirus infection
    102987227 (CTNNB1)
SSDB
Motif
Pfam: Arm Cnd1 Adaptin_N HEAT_2 HEAT_EZ KAP Atx10homo_assoc Arm_2 Queuosine_synth
Other DBs
NCBI-GeneID: 102987227
NCBI-ProteinID: XP_007113672
UniProt: A0A2Y9F1X5
LinkDB
Position
18
AA seq 781 aa
MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTT
QVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPT
NVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSK
KEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPAL
VKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDC
LQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEA
GGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCA
AGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEM
AQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLL
VRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFV
QLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLF
RMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFH
SGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTD
L
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggctacccaagctgacttgatggagctggacatggccatggagccagacagaaaagca
gctgttagtcactggcagcaacaatcttacctggactctggaatccattctggtgccact
accacagctccttctctgagtggtaaaggcaatcctgaggaagaggatgtggataccacc
caagtcctgtatgagtgggagcagggattttctcagtccttcactcaagaacaagtagct
gatatcgatggacagtatgcaatgactcgagctcagagggtacgagctgctatgttcccc
gagacgttagatgagggcatgcagatcccatctacacagtttgatgccgctcatcccact
aatgtccagcgtctggctgaaccatcacagatgctgaaacatgcagttgtaaatttgatt
aactatcaggatgatgcagaacttgccacacgtgcaatccctgaattgacaaaactgcta
aatgatgaagaccaggtggtggttaataaggctgcagttatggtccatcagctttctaaa
aaggaagcttccagacacgccatcatgcgttctcctcagatggtgtctgctattgtacgc
accatgcagaatacaaatgatgtggaaacggctcgctgtactgctgggaccttgcacaat
ctctcccatcatcgtgagggcttgctggccatctttaagtccgggggcattcctgccctg
gtgaagatgcttggttcaccagtggattctgtattgttttatgccattacaactctccac
aaccttttattgcatcaggaaggagctaaaatggcagtgcgtttagctggcgggctgcag
aaaatggttgccttgctcaacaaaacaaatgttaaattcttggctattacaacagactgc
cttcagattttagcttatggcaatcaagaaagcaagctgatcattttggctagtggtgga
cctcaagctttagtgaatataatgaggacctacacctatgagaaactactgtggaccaca
agcagagtactgaaggtgctgtctgtctgctctagtaataagccggctattgtagaagct
ggtggaatgcaagctttaggacttcacctgacagatccaagtcaacgtcttgttcagaat
tgtctttggactctgaggaatctttcagatgctgcaactaaacaggaagggatggaaggt
cttcttgggacccttgttcagcttctgggctcagatgatataaatgtggtcacctgcgca
gctggaattctttctaatctcacctgcaataattacaagaacaagatgatggtgtgccaa
gtgggtggtatagaggctcttgtgcgtactgtccttcgtgctggtgacagggaggatatc
actgagcctgccatctgtgctcttcgtcatctgaccagccgacaccaggaagctgagatg
gcccagaatgctgttcgccttcactatggactgccagttgtggttaaactcctacatcca
ccatcccattggcctctgatcaaggctaccgttggattgattcgaaatcttgccctttgt
cccgcaaatcacgcacctttgcgtgagcagggtgccattccacgactagttcagttgctg
gttcgtgcacatcaggatacccagcgccgtacatctatggggggaacacagcagcagttt
gtggagggggtccgcatggaagaaatagttgaaggttgtactggagcccttcacatccta
gctcgggatgttcacaaccgaattgttatcagaggcctaaataccattccattgtttgtg
cagctgctttattctcccattgaaaatatccaaagagtagctgcaggggtcctctgtgaa
cttgctcaggacaaggaggctgcagaagctattgaagctgagggagccacagctcctctg
acagaattacttcattctaggaatgaaggtgtggcaacatatgcagctgctgttttattc
cgaatgtctgaggacaagccacaggattataagaaacggctttcggttgagctgaccagt
tctctcttcagaacggagccaatggcttggaatgagactgctgatcttggacttgatatc
ggtgcccagggagaaccccttggatatcgccaggatgatcccagctatcgttcttttcac
tctggtggatacggccaggatgccttgggtatggaccccatgatggagcatgagatgggc
ggccaccaccctggtgctgactatccagttgatgggctgccagatctggggcatgcccag
gacctcatggatgggctgcctccaggtgacagcaatcagttggcctggtttgatactgac
ctgtaa

DBGET integrated database retrieval system