KEGG   Physeter catodon (sperm whale): 102987302
Entry
102987302         CDS       T06011                                 

Gene name
IL3RA
Definition
(RefSeq) interleukin-3 receptor subunit alpha
  KO
K04737  interleukin 3 receptor alpha
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04060  Cytokine-cytokine receptor interaction
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04630  JAK-STAT signaling pathway
pcad04640  Hematopoietic cell lineage
pcad05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102987302 (IL3RA)
   04151 PI3K-Akt signaling pathway
    102987302 (IL3RA)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102987302 (IL3RA)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102987302 (IL3RA)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102987302 (IL3RA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102987302 (IL3RA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pcad04050]
    102987302 (IL3RA)
   04090 CD molecules [BR:pcad04090]
    102987302 (IL3RA)
Cytokine receptors [BR:pcad04050]
 Interleukin receptor families
  IL3 receptor family
   102987302 (IL3RA)
CD molecules [BR:pcad04090]
 Proteins
  102987302 (IL3RA)
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind EpoR_lig-bind Y_Y_Y InlK_D3 IL12p40_C
Other DBs
NCBI-GeneID: 102987302
NCBI-ProteinID: XP_028348276
UniProt: A0A455BWT5
LinkDB
Position
7
AA seq 384 aa
MAFVWLAVFLVPVSGLLPPDHDSYPIDISDPDPPIKNLRMEPERKRLTWDLHGNVSEIMC
FINSKAFTKARKRTYCSIPDLSCQVTNYSIKVTKGQPFSTWIQYPRQEGNPRAAAENLTC
WVHDVDFLTCSWAVGRQAPRDVQYNLYLENLDSYEKWPCSQYRADEQGTNVQCRFHNISV
LSKDQTRFLVNGTSSGSKIPCSETSDKLAKIEVLAAPNITSRWCNQSYLFMRWQMSSHFN
DDFKYELQIQKGMELAYKQEIYKAFLELNNPGTYTVQVRARDATFSHYKPWGPWSVPQHF
VCEEGARLPAWLTCLLIALGTLLPTGLVLLFCRFSVMQKLFPPIPHMKDHINGKLQNGRT
MTWDPDQDSQEECPVVEVQVLGET
NT seq 1155 nt   +upstreamnt  +downstreamnt
atggctttcgtctggctggctgtgttcctggtgcctgtctccggcctgctgccaccggac
cacgactcttaccctatagacatttccgatccagacccaccgattaagaacctaaggatg
gagccagaaagaaaaagattgacctgggacctccatggaaacgtttccgaaattatgtgt
ttcatcaattcaaaagctttcactaaggcacggaaaagaacgtattgcagtattcctgac
ttgtcatgccaagtgacaaactacagcatcaaggtgaccaaaggtcagccattctccacg
tggattcagtatcctagacaagaagggaatcccagggcggctgcagaaaacctgacctgc
tgggttcacgacgtggatttcctgacgtgcagctgggcggtgggccggcaggccccgagg
gacgtgcagtacaatctctacctggagaacctagactcctatgagaagtggccgtgctcc
cagtacagagcagatgagcaagggacaaacgtccagtgccgttttcacaacatctctgtg
ttatccaaggatcaaacccgtttcctggtgaacggcaccagcagtggctccaaaatcccc
tgctctgaaacgagcgataaattagccaaaatcgaggtattagcagctcccaacatcact
agcaggtggtgcaaccaaagctacttgttcatgcggtggcaaatgagcagtcactttaac
gatgacttcaagtatgaacttcagatacagaagggtatggagctcgcctacaaacaggag
atctacaaagccttcttggagctgaacaatcctgggacctacacggtgcaagtaagggcc
agggatgccaccttctcccattacaaaccttggggcccgtggagtgtcccccaacacttc
gtgtgtgaggagggcgcgcgcctccccgcctggctgacgtgtttgctgatcgcgctgggg
acgctgctgcctacggggctcgtgctcctgttctgcaggttctcggtgatgcagaagctg
ttccctcccatccctcacatgaaagaccatatcaatggcaaacttcagaacggaaggacg
atgacctgggaccccgaccaagacagccaggaggagtgtccagtggtcgaggtgcaggtt
ctgggggaaacatga

DBGET integrated database retrieval system