KEGG   Physeter catodon (sperm whale): 102987522
Entry
102987522         CDS       T06011                                 

Gene name
MET
Definition
(RefSeq) hepatocyte growth factor receptor
  KO
K05099  proto-oncogene tyrosine-protein kinase Met [EC:2.7.10.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04360  Axon guidance
pcad04510  Focal adhesion
pcad04520  Adherens junction
pcad05100  Bacterial invasion of epithelial cells
pcad05144  Malaria
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05211  Renal cell carcinoma
pcad05218  Melanoma
pcad05223  Non-small cell lung cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102987522 (MET)
   04014 Ras signaling pathway
    102987522 (MET)
   04015 Rap1 signaling pathway
    102987522 (MET)
   04020 Calcium signaling pathway
    102987522 (MET)
   04151 PI3K-Akt signaling pathway
    102987522 (MET)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102987522 (MET)
   04520 Adherens junction
    102987522 (MET)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    102987522 (MET)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102987522 (MET)
   05202 Transcriptional misregulation in cancer
    102987522 (MET)
   05206 MicroRNAs in cancer
    102987522 (MET)
   05205 Proteoglycans in cancer
    102987522 (MET)
   05230 Central carbon metabolism in cancer
    102987522 (MET)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102987522 (MET)
   05226 Gastric cancer
    102987522 (MET)
   05218 Melanoma
    102987522 (MET)
   05211 Renal cell carcinoma
    102987522 (MET)
   05223 Non-small cell lung cancer
    102987522 (MET)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102987522 (MET)
  09174 Infectious disease: parasitic
   05144 Malaria
    102987522 (MET)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102987522 (MET)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102987522 (MET)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102987522 (MET)
Protein kinases [BR:pcad01001]
 Receptor tyrosine kinases (RTK)
  MET family
   102987522 (MET)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Sema Pkinase TIG PSI Kinase-like Pkinase_fungal Linker_histone
Other DBs
NCBI-GeneID: 102987522
NCBI-ProteinID: XP_007116564
UniProt: A0A2Y9F7T1
LinkDB
Position
5
AA seq 1412 aa
MLERWISGLSGAKEMKMQTWESSLYYKLLTMKASAVLAPGILVLLFTLVQKSNGECKEAL
VKSKMNVNMQYQLPNFTAETPIQNVVSHKHHIYLGAINYLYVLNDKDLQKVAEYKTGPVL
EHPDCFPCQNCSHKANLSGGVWKDNINMALLVDTYYDDQLISCGSVHRGTCQRHVLPPDN
TANIQSEVHCMYSPQADEEPSQCPDCVVSALGTKVLLSEKDRFINFFVGNTINSSYLPDH
SLHSISVRRLKETQDGFKFLTDQSYIDVLPEFRDSYPIKYVHAFESNHFIYFLTVQRETL
DAQTFHTRIIRFCSVDSGLHSYMEMPLECILTEKRRKRSTREEVFNILQAAYVSKPGTQL
AKQIGANLNDDILYGVFAQSKPDSVEPMNRSAVCAFPVKYVNEFFNKIVNKNNVRCLQHF
YGPNHDHCFNRTLLRNSSGCEVHSDEYRTEFTTALQRVDLFMGQFNQVLLTSISTFIKGD
LTIANLGTSEGRFMQVVVSRSGSLTPHVNFRLDSHPVSPEAIVEHPLNQNGYTLVVTGKK
ITKIPLNGLGCEHFQSCSQCLSAPSFVQCGWCHDKCVRLEECPGGTWTQETCLPTIYKVF
PTSAPLEGGTTLTICGWDFGFKRNNKFDLKKTKVLLGNESCTLTLSESTINMLKCTVGPA
MNEHFNMSIVISNSRGTVHYSTFSYVDPIIKSISPSYGPKTGGTLLTLTGKHLNSGNSRH
ISIGGKTCTLKSVSDSILECYTPAQSTPTEFPIKLKIDLANREMNSFIYREDPIVYEIHP
TKSFVSGGSTITGVGKNLNSVSILRMVINVHEAGRNFTVACQHRSNSEIICCTTPSLQQL
NLQLPLKTKAFFMLDGIHSKYFDLIYVHNPVFKPFEKPVMISIGNENVLEIKGNDIDPEA
VKGEVLKVGNKSCENIQSHSEAVLCTVPNDLLKLNSELNIEWKQAISSTVLGKVIVQPDQ
NFTGLIVGVVSISIILLLLLGLFLWLKKRKQIKDLGSELVRYDARVHTPHLDRLVSARSV
SPTTEMVSNESVDYRATFPEDQFPNSSQNGSCRQVQYPLTDLSPILTSGDSDISSPLLQN
TVHIDLSALNPELVQAVQHVVIGPSSLIVHFNEVIGRGHFGCVYHGTLLDNDDKKIHCAV
KSLNRITDIGEVSQFLTEGIIMKDFSHPNVLSLLGICLRSEGSPLVVLPYMKHGDLRNFI
RNETHNPTVKDLIGFGLQVAKGMKYLASKKFVHRDLAARNCMLDEKFTVKVADFGLARDV
YDKEYYSVHNKTGAKLPVKWMALESLQTQKFTTKSDVWSFGVLLWELMTRGAPPYPDVNT
FDITVYLLQGRRLLQPEYCPDPLYEVMLKCWHPKAELRPSFSELVSKISAIFSTFIGEHY
VHVNATYVNVKCVAPYPSLLSSQDNVDGEGDT
NT seq 4239 nt   +upstreamnt  +downstreamnt
atgcttgagagatggatttctggactctctggagctaaagagatgaagatgcagacctgg
gagtcttcactctattataaacttctcaccatgaaggcctctgctgtgcttgcacctggc
atccttgtgcttctgtttaccttggtgcagaagagcaatggggagtgtaaagaggcacta
gtaaagtccaagatgaatgtgaacatgcagtatcagcttcctaacttcacagcagaaaca
cccattcagaatgtcgtttcgcacaagcatcacatttacctcggtgccattaactacctt
tacgttttaaatgacaaagaccttcagaaggttgctgagtacaagactgggcctgtgctg
gaacacccagattgtttcccatgtcagaactgcagccacaaagccaatttatcaggtggc
gtttggaaagataacatcaacatggctctgcttgttgacacgtactatgatgaccaactc
attagctgcggcagtgtccacagagggacctgccagcgacacgtccttccacctgacaat
actgctaacatacagtcggaggttcattgcatgtactctccacaggcagacgaagagccc
agccaatgtcctgactgtgtggtgagtgccctgggaaccaaagtcctgctgtctgaaaag
gatcgattcatcaacttcttcgtgggcaataccataaattcttcttaccttccagatcat
tcattgcattcgatatctgtgagaaggctaaaggaaacgcaagatggttttaagtttttg
acagaccaatcctatattgatgttttacctgagttccgagattcctaccccattaagtat
gtccacgcctttgaaagcaaccattttatttactttttgacggtccaacgggaaactcta
gatgctcagacttttcacacaagaataatcaggttctgttccgtagactctggtttgcat
tcgtacatggaaatgcctctggagtgtattctcacagaaaagagaagaaagagatccaca
agggaggaagtgtttaatattctccaagctgcgtatgtcagtaagcctgggacccagctc
gctaagcaaataggtgccaacctgaatgatgacattctctacggggtgtttgcacaaagc
aaaccagattctgtcgaaccaatgaatcgctctgctgtctgtgcgttccctgtcaaatat
gtcaatgagttcttcaacaagatcgtcaacaaaaacaatgtgagatgtctccagcatttt
tatgggcccaaccacgatcactgcttcaataggacacttttgagaaattcatcaggctgc
gaagtgcacagtgatgaataccgaacggagtttaccacagctttgcagcgtgttgactta
ttcatgggccagttcaaccaagtcctcttaacatctatatccacctttattaaaggagac
ctcaccatcgctaatcttggaacgtcagagggtcgattcatgcaggttgtggtttctcga
tcaggatcattaaccccacacgtgaattttcgcctggattcccaccctgtgtctccagaa
gcaattgtggagcacccgctaaaccaaaatggctatacactcgttgtcactgggaagaag
atcaccaagatcccgctgaatggcttgggctgtgaacatttccagtcctgcagtcagtgc
ctctccgccccttcctttgtgcagtgtggctggtgccatgataaatgtgtgcgattggag
gaatgccctggtggaacatggactcaagagacctgtctgcctacaatctacaaggttttc
ccaactagtgccccccttgaaggagggacaacgctgaccatatgtggctgggactttgga
ttcaagagaaataataaatttgacttgaagaaaaccaaagttctccttggaaatgagagc
tgcaccttgaccttaagtgagagcacaataaacatgttgaaatgcacagttggtcctgca
atgaatgaacatttcaatatgtccatagttatttcaaacagtcgagggaccgtacattat
agtacattttcctatgtggatcctataataaaaagtatttctccaagttatggtcctaaa
actggtggcactttacttacattaactggaaagcacctaaacagtggaaattctagacac
atttcaattggtggaaaaacatgtactttaaaaagtgtttcagatagtattctcgaatgt
tataccccagcccaaagcactccaactgagtttcctattaaattgaaaattgacttagcc
aaccgagaaatgaacagcttcatttaccgggaagaccccattgtctatgaaatacatccc
accaaatcttttgttagtggtgggagcacaataacaggtgttggaaaaaacctgaattca
gttagtatcctgaggatggtaataaatgtgcacgaagcaggaaggaactttacagtggca
tgtcagcatcgctctaattcggagataatctgctgtacaactccttcactacaacagctg
aacctacaacttcccctgaaaaccaaagcctttttcatgttagatgggatccattccaaa
tactttgatctcatttatgtacataatcctgtgtttaagccttttgaaaagccagtgatg
atctcaataggcaatgaaaatgtactggaaattaagggaaacgatattgaccctgaagca
gttaaaggtgaagtgttaaaagttggaaataagagctgtgagaatatacagtcacattct
gaagccgttttatgtacggtccccaatgacctgctgaaattgaacagcgaactaaatata
gagtggaagcaagcaatttcttcaaccgtccttggaaaagtgatagttcaaccagatcag
aatttcacaggactgattgttggtgttgtctcaatatcaataatactcttattattactt
gggcttttcctgtggctgaaaaagagaaagcaaattaaagatctggggagtgaattagtt
cgctatgatgcaagagtacacactcctcatttggataggcttgtaagtgcccgaagtgta
agcccaactacagaaatggtttcaaatgaatctgtagactaccgagctacttttccagaa
gaccagtttcctaactcatctcagaatgggtcatgcagacaagtgcagtatcctctgaca
gacctatcccccatcctaactagtggggactctgatatatccagtccattactgcaaaat
actgtccacattgacctcagtgctctaaatccagagctggtccaggcagttcagcacgta
gtgattgggccaagcagcctgattgtgcatttcaatgaagtcataggaagaggacatttc
gggtgtgtatatcatgggactttgttggacaatgatgataagaaaattcactgtgctgtg
aaatccttgaatagaatcactgacataggagaagtttcccaatttctgaccgagggaatc
atcatgaaagattttagtcatcccaatgttctctcgctcttgggaatctgccttcgaagt
gaggggtctccactggtggtcctaccatacatgaaacatggggatcttcgaaatttcatt
agaaatgagactcacaaccccactgtaaaagatcttattggctttggtcttcaagtagcc
aaaggcatgaaataccttgcaagcaaaaagtttgtccacagagacttggctgcaagaaac
tgtatgctggatgaaaaattcactgtcaaagttgctgattttggccttgccagagacgtg
tatgataaggaatactatagcgtacacaacaaaacaggtgcaaaactgccagtgaagtgg
atggctttagagagcctgcaaactcagaaatttaccaccaagtcagatgtgtggtccttt
ggcgtgctcctctgggaactgatgacaagaggagcaccaccttatcctgatgtcaacacc
tttgatataactgtatatttgttgcaaggcagaaggctcctacaacctgaatactgccca
gatcccctgtatgaagtgatgctgaaatgctggcaccctaaagctgaactgcgcccatcc
ttttctgaactggtctccaagatatcagcgatattctctactttcattggggagcattat
gtccatgtgaacgctacatacgtgaatgtcaaatgtgtcgctccatatccttctctgttg
tcatcacaagataatgttgatggcgagggggatacatga

DBGET integrated database retrieval system