KEGG   Physeter catodon (sperm whale): 102987866
Entry
102987866         CDS       T06011                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase isoform X2
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad04024  cAMP signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04218  Cellular senescence
pcad04270  Vascular smooth muscle contraction
pcad04360  Axon guidance
pcad04370  VEGF signaling pathway
pcad04371  Apelin signaling pathway
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04625  C-type lectin receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04666  Fc gamma R-mediated phagocytosis
pcad04720  Long-term potentiation
pcad04722  Neurotrophin signaling pathway
pcad04726  Serotonergic synapse
pcad04730  Long-term depression
pcad04810  Regulation of actin cytoskeleton
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04914  Progesterone-mediated oocyte maturation
pcad04915  Estrogen signaling pathway
pcad04916  Melanogenesis
pcad04917  Prolactin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04929  GnRH secretion
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05034  Alcoholism
pcad05132  Salmonella infection
pcad05152  Tuberculosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102987866 (RAF1)
   04012 ErbB signaling pathway
    102987866 (RAF1)
   04014 Ras signaling pathway
    102987866 (RAF1)
   04015 Rap1 signaling pathway
    102987866 (RAF1)
   04370 VEGF signaling pathway
    102987866 (RAF1)
   04371 Apelin signaling pathway
    102987866 (RAF1)
   04630 JAK-STAT signaling pathway
    102987866 (RAF1)
   04068 FoxO signaling pathway
    102987866 (RAF1)
   04072 Phospholipase D signaling pathway
    102987866 (RAF1)
   04071 Sphingolipid signaling pathway
    102987866 (RAF1)
   04024 cAMP signaling pathway
    102987866 (RAF1)
   04022 cGMP-PKG signaling pathway
    102987866 (RAF1)
   04151 PI3K-Akt signaling pathway
    102987866 (RAF1)
   04150 mTOR signaling pathway
    102987866 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102987866 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    102987866 (RAF1)
   04218 Cellular senescence
    102987866 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102987866 (RAF1)
   04540 Gap junction
    102987866 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    102987866 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102987866 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102987866 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    102987866 (RAF1)
   04660 T cell receptor signaling pathway
    102987866 (RAF1)
   04662 B cell receptor signaling pathway
    102987866 (RAF1)
   04664 Fc epsilon RI signaling pathway
    102987866 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    102987866 (RAF1)
   04062 Chemokine signaling pathway
    102987866 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102987866 (RAF1)
   04929 GnRH secretion
    102987866 (RAF1)
   04912 GnRH signaling pathway
    102987866 (RAF1)
   04915 Estrogen signaling pathway
    102987866 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    102987866 (RAF1)
   04917 Prolactin signaling pathway
    102987866 (RAF1)
   04921 Oxytocin signaling pathway
    102987866 (RAF1)
   04926 Relaxin signaling pathway
    102987866 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    102987866 (RAF1)
   04919 Thyroid hormone signaling pathway
    102987866 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    102987866 (RAF1)
   04916 Melanogenesis
    102987866 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    102987866 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    102987866 (RAF1)
   04720 Long-term potentiation
    102987866 (RAF1)
   04730 Long-term depression
    102987866 (RAF1)
   04722 Neurotrophin signaling pathway
    102987866 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    102987866 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102987866 (RAF1)
   05206 MicroRNAs in cancer
    102987866 (RAF1)
   05205 Proteoglycans in cancer
    102987866 (RAF1)
   05230 Central carbon metabolism in cancer
    102987866 (RAF1)
   05231 Choline metabolism in cancer
    102987866 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102987866 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102987866 (RAF1)
   05212 Pancreatic cancer
    102987866 (RAF1)
   05225 Hepatocellular carcinoma
    102987866 (RAF1)
   05226 Gastric cancer
    102987866 (RAF1)
   05214 Glioma
    102987866 (RAF1)
   05221 Acute myeloid leukemia
    102987866 (RAF1)
   05220 Chronic myeloid leukemia
    102987866 (RAF1)
   05218 Melanoma
    102987866 (RAF1)
   05211 Renal cell carcinoma
    102987866 (RAF1)
   05219 Bladder cancer
    102987866 (RAF1)
   05215 Prostate cancer
    102987866 (RAF1)
   05213 Endometrial cancer
    102987866 (RAF1)
   05224 Breast cancer
    102987866 (RAF1)
   05223 Non-small cell lung cancer
    102987866 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102987866 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    102987866 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    102987866 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102987866 (RAF1)
   05152 Tuberculosis
    102987866 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102987866 (RAF1)
   05161 Hepatitis B
    102987866 (RAF1)
   05160 Hepatitis C
    102987866 (RAF1)
   05164 Influenza A
    102987866 (RAF1)
   05163 Human cytomegalovirus infection
    102987866 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102987866 (RAF1)
   05165 Human papillomavirus infection
    102987866 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102987866 (RAF1)
   01522 Endocrine resistance
    102987866 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102987866 (RAF1)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102987866 (RAF1)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   102987866 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 102987866
NCBI-ProteinID: XP_007126260
UniProt: A0A2Y9FMZ7
LinkDB
Position
18
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGPSCISPTIVQQFGYQRRASDDGKLTDPSKTSSTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDICQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNIRQLLLFPNSTVGDSGVPTLPSLTMRRMRESVSRMPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHGESGSPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSSTQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSILWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHISNRDQIIFMVGRGYTSPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagacgca
gtgtttgatggccccagctgcatctcccctacaatagttcagcagtttggctatcagcgt
cgggcatcagatgatggcaaacttacggacccttctaagacaagcagcactatccgtgtt
tttttgccaaacaagcaaagaacagtggtcaatgtgcggaatggaatgagcttgcatgac
tgccttatgaaagctctcaaggtgaggggcctgcaaccagagtgctgtgcagttttcaga
cttctccacgaacacaagggtaaaaaagcacgtttagattggaatactgatgctgcctcg
ttgattggagaggaacttcaagtagatttcctggaccatgttccactcacaacacacaac
tttgctcggaagaccttcctgaagcttgccttctgtgacatctgtcagaagttcctgctg
aatgggtttagatgtcagacttgtggctacaagtttcacgagcattgtagcaccaaagta
cctactatgtgtgtggactggagtaatatcagacaactcttgctgttcccaaattccact
gttggtgatagtggggtcccaacactgccttctttgacaatgcgtcggatgcgagagtct
gtttcccggatgcctgttagttcccagcacagatactccacaccccacgctttcacattc
aacacctccagcccctcctctgaaggttccctgtcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccttgcccgtggacagcaggatgattgaggatgca
attcggagtcatggtgaatcaggctcaccttcagccttgtccagcagtcccaacaatctg
agcccaacaggctggtcacagcccaaaacccctgtgccggcacagagagagcgggcaccg
ggatccagcacccaggagaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctccactcggattgggtcaggctccttt
ggaactgtttataagggcaagtggcatggagacgttgcagtaaagattctaaaggttgtt
gaccccacaccagagcagttccaggccttcaggaatgaagtggctgtccttcgcaaaacc
cggcacgtgaacatcctgctcttcatggggtacatgacgaaggacaacctggcaattgtg
acccagtggtgcgagggcagcagcctctataaacacctgcacgtccaggagaccaagttc
cagatgttccagttgattgacattgcccggcagacggctcagggaatggactatttgcat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttctccatgaaggcctg
acggtgaaaattggagactttggtttggcaacagtgaagtcgcgctggagtggttctcag
caggttgaacaacccaccggctccatcttgtggatggccccagaggtgattcgaatgcag
gacaataacccgttcagcttccagtctgacgtctactcgtacggcatcgtgctgtatgag
ctcatgacaggggagctgccctactcccacatcagcaaccgcgatcagatcatcttcatg
gtaggccgagggtacacctccccagaccttagtaagctgtacaagaactgccccaaagca
atgaagaggctggtagccgactgtgtgaagaaagttaaggaagagaggcctctttttccc
cagatcctgtcttccattgagctgctccaacactctctaccgaaaatcaaccggagcgct
tctgagccatccctgcaccgggcggcccataccgaggacatcaatgcctgcacgctgacc
acatcccctagattgcctgtcttctag

DBGET integrated database retrieval system