KEGG   Physeter catodon (sperm whale): 102987940
Entry
102987940         CDS       T06011                                 

Gene name
MLH1
Definition
(RefSeq) DNA mismatch repair protein Mlh1
  KO
K08734  DNA mismatch repair protein MLH1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01524  Platinum drug resistance
pcad03430  Mismatch repair
pcad03460  Fanconi anemia pathway
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    102987940 (MLH1)
   03460 Fanconi anemia pathway
    102987940 (MLH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102987940 (MLH1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102987940 (MLH1)
   05226 Gastric cancer
    102987940 (MLH1)
   05213 Endometrial cancer
    102987940 (MLH1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102987940 (MLH1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102987940 (MLH1)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    MutL homologs
     102987940 (MLH1)
SSDB
Motif
Pfam: Mlh1_C DNA_mis_repair HATPase_c_3 HATPase_c Hfx_Cass5
Other DBs
NCBI-GeneID: 102987940
NCBI-ProteinID: XP_023988064
UniProt: A0A2Y9TI72
LinkDB
Position
18
AA seq 758 aa
MSLVAGVIRRLDETVVNRIAAGEVIQRPANAIKEMIENCLDAKSTSIQVVIKEGGLKLIQ
IQDNGTGIRKEDLEIVCERFTTSKLQSFEDLARISTYGFRGEALASISHVAHVSITTKTA
DGKCAYRAHYSDGKLKAPPKPCAGNQGTQITVEDLFYNISTRRKALKNPSEEYGKILEVV
GRYSVHNSGISFSVKKQGETVADVRTLPNATTVDNIRSIFGNAVSRELIEVGCEDKTLAF
KMNGYISNANYSVKKCIFLLFINHRLVESTSLRKAIETVYAAYLPKNTHPFLYLSLEISP
QNVDVNVHPTKHEVHFLHEDSILERVQQHIESRLLGSNASRTYFTQTLLPGLTGPSGEVV
KSTTGVTLSSIAGSGDKVYAHQMVRTDCREQKLDAFLQPVSKALSSQPQAVVLEDRTAAS
SSGARQQDEEMLELSAPAEVAAKNQGLEEDATKRTADSSEKTGPSSSPENPRKRHREGSD
VEMVEDASRKEMTAACTPRRRIINLTSILSLQEEISERGHETLQEVLRNHSFVGCVNPQW
ALAQHQTKLYLLNTTKLSEELFYQILIYDFANFGVLRLSEPAPLFDLAVLALDSPESGWT
EEDGPKEGLAEYIVEFLKKKAEMLADYFSLEIDEEGNLVGLPLLIDNYVPPLEGLPIFIL
RLATEVNWDDEKECFESLGKECAMFYSIRKQYVSEESTLSGQQSEVPGSTPNPWKWTVEH
VVYKAFRSHLLPPKHFTEDGNILQLANLPDLYKVFERC
NT seq 2277 nt   +upstreamnt  +downstreamnt
atgtcgctggtagcgggggttatccggcggctggacgagacagtggtgaaccgcatcgcg
gcaggggaagttatccagcgcccggctaatgccatcaaggagatgattgagaactgttta
gatgcaaaatccacaagtattcaagtggttattaaagagggaggcctgaagttgattcag
atccaagacaatggcaccgggatcaggaaagaagatctggagattgtgtgtgagaggttc
accacaagtaaactgcagtcctttgaggatttagctcgtatttctacctatggctttcgg
ggggaggctttggccagcataagccatgtggctcacgtcagcattacaaccaaaacagct
gatgggaagtgtgcatacagagcacattactcagatggaaagctgaaagctccacctaaa
ccatgtgcaggcaatcaagggacccagatcacggtagaggaccttttttacaacatatcc
acgaggaggaaagctttaaaaaatccaagtgaagagtatgggaaaattctggaagttgtc
ggcaggtattcagtacacaattcaggcattagtttctcggttaaaaaacaaggtgagacg
gtagccgacgtcaggacactgcccaatgccacaaccgtggacaacattcgctccattttt
ggaaatgctgttagccgagaattgatagaagttgggtgtgaggataaaaccctcgccttc
aaaatgaatggctacatatccaatgcaaactactcggtgaagaagtgcatcttcttactc
ttcatcaatcatcgtctggtagagtcaacttccttaagaaaagccatagaaacggtgtat
gcagcatatttgcccaaaaacacacacccgttcctgtacctcagtttagaaatcagcccc
cagaatgtggatgtcaatgtgcaccccacgaagcacgaagttcacttcctgcacgaggac
agcatcctggagcgggtgcagcagcacattgagagcaggctcctgggctccaacgcctcc
aggacctatttcacccagactttactaccaggtcttactggcccctctggggaagtggtt
aaatccacaacaggtgtgaccctctcatctattgctggaagtggcgacaaggtgtatgcc
caccagatggtccgcacagattgccgggaacagaaactcgatgccttcctgcagcctgtg
agcaaggccctatccagtcagccccaggctgttgtcctagaggacaggacagctgcttct
agtagcggggccaggcagcaggatgaggaaatgcttgaactctcagctcctgctgaagtg
gctgccaagaatcagggcttggaggaggatgcaacaaagaggactgcagactcgtcagag
aagacagggccctcttccagccccgagaaccccagaaagagacatcgggaaggctctgat
gtggaaatggtggaggatgcatcccgaaaggaaatgacagcagcttgtaccccccggaga
aggatcattaacctcaccagcattctgagtctccaggaagaaatcagtgagcggggacat
gagactctccaggaggtgctgcgtaaccactcgtttgtgggctgtgtgaatcctcaatgg
gccttggcacagcatcagaccaagttataccttctcaacaccaccaaacttagtgaagaa
ctgttctaccagattctcatttatgattttgccaattttggtgttctgaggttatcggag
ccagcaccgctctttgacctcgccgtgcttgccttagatagtcctgagagtggctggaca
gaggaagatggtcccaaagaaggacttgccgaatacattgttgagtttctgaaaaagaag
gctgagatgcttgcagattacttctctttggagattgatgaggaagggaacctggttgga
ttaccccttctgatcgacaactacgtgccccccttggagggtctgcctatcttcattctc
cgactggccactgaggtgaactgggatgatgaaaaggaatgttttgaaagcctcggtaaa
gaatgtgcaatgttttactccatccggaagcagtatgtgtctgaggagtcgaccctctca
ggccagcagagtgaagtgcccggctctactccaaacccctggaagtggactgtggagcat
gtcgtctataaagccttccgttcacaccttctgcctccgaaacatttcacagaagatgga
aacatcctgcagcttgctaatctgcccgatctatataaagtcttcgagaggtgttaa

DBGET integrated database retrieval system