KEGG   Physeter catodon (sperm whale): 102987942
Entry
102987942         CDS       T06011                                 

Gene name
BCL2
Definition
(RefSeq) apoptosis regulator Bcl-2 isoform X1
  KO
K02161  apoptosis regulator Bcl-2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04064  NF-kappa B signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04115  p53 signaling pathway
pcad04140  Autophagy - animal
pcad04141  Protein processing in endoplasmic reticulum
pcad04151  PI3K-Akt signaling pathway
pcad04210  Apoptosis
pcad04215  Apoptosis - multiple species
pcad04217  Necroptosis
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04340  Hedgehog signaling pathway
pcad04510  Focal adhesion
pcad04621  NOD-like receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04722  Neurotrophin signaling pathway
pcad04725  Cholinergic synapse
pcad04915  Estrogen signaling pathway
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04933  AGE-RAGE signaling pathway in diabetic complications
pcad05014  Amyotrophic lateral sclerosis
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05132  Salmonella infection
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05161  Hepatitis B
pcad05162  Measles
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05215  Prostate cancer
pcad05222  Small cell lung cancer
pcad05226  Gastric cancer
pcad05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102987942 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    102987942 (BCL2)
   04630 JAK-STAT signaling pathway
    102987942 (BCL2)
   04064 NF-kappa B signaling pathway
    102987942 (BCL2)
   04066 HIF-1 signaling pathway
    102987942 (BCL2)
   04071 Sphingolipid signaling pathway
    102987942 (BCL2)
   04151 PI3K-Akt signaling pathway
    102987942 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102987942 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    102987942 (BCL2)
   04215 Apoptosis - multiple species
    102987942 (BCL2)
   04217 Necroptosis
    102987942 (BCL2)
   04115 p53 signaling pathway
    102987942 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102987942 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102987942 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    102987942 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    102987942 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    102987942 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    102987942 (BCL2)
   04722 Neurotrophin signaling pathway
    102987942 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102987942 (BCL2)
   05206 MicroRNAs in cancer
    102987942 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102987942 (BCL2)
   05226 Gastric cancer
    102987942 (BCL2)
   05215 Prostate cancer
    102987942 (BCL2)
   05222 Small cell lung cancer
    102987942 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    102987942 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    102987942 (BCL2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102987942 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    102987942 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102987942 (BCL2)
   05152 Tuberculosis
    102987942 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102987942 (BCL2)
   05161 Hepatitis B
    102987942 (BCL2)
   05162 Measles
    102987942 (BCL2)
   05168 Herpes simplex virus 1 infection
    102987942 (BCL2)
   05169 Epstein-Barr virus infection
    102987942 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102987942 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102987942 (BCL2)
   01524 Platinum drug resistance
    102987942 (BCL2)
   01522 Endocrine resistance
    102987942 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102987942 (BCL2)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102987942 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 102987942
NCBI-ProteinID: XP_007105176
UniProt: A0A2Y9EML1
LinkDB
Position
19
AA seq 230 aa
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAASPGAAPAPGIFSSQPGRTPAPS
RTSPPPPQTAPAGGPALSPVPPVVHLTLRQAGDDFSHRYRRDFAEMSSQLHLTPFTARGR
FATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWI
QDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACVTLGAYLGHK
NT seq 693 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tataagctgtcgcagaggggctacgagtgggatgccggagacgcgggcgccgcttccccg
ggggccgcccccgcgccgggcatcttctcctcccagcctgggcgcaccccagcgccgtcc
aggacctccccgccgccgccccagaccgcccccgccggggggcctgcgctcagccccgtg
ccacccgtggttcacctgaccctgcgccaggcgggtgatgacttctctcatcgctaccgc
cgcgacttcgccgagatgtccagccagctgcacctgacgcccttcaccgcgaggggacgc
tttgccacggtggtggaggagctcttcagggatggggtgaactgggggaggattgtggcc
ttctttgagttcggtggggtcatgtgtgtggagagcgtcaaccgggagatgtcccccctg
gtggacaacatcgccctgtggatgactgagtacctgaaccgacacctgcacacctggatc
caggataacggaggctgggatgcctttgtggagctgtatggtcccagcatgcggcccctg
tttgatttctcctggctgtctctgaaggcactgctaagtctggccctggtgggagcttgc
gtcaccctgggtgcctatctgggccataagtga

DBGET integrated database retrieval system