KEGG   Physeter catodon (sperm whale): 102988128
Entry
102988128         CDS       T06011                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04110  Cell cycle
pcad04151  PI3K-Akt signaling pathway
pcad04218  Cellular senescence
pcad04310  Wnt signaling pathway
pcad04350  TGF-beta signaling pathway
pcad04390  Hippo signaling pathway
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04630  JAK-STAT signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad05132  Salmonella infection
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05213  Endometrial cancer
pcad05216  Thyroid cancer
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05222  Small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102988128 (MYC)
   04012 ErbB signaling pathway
    102988128 (MYC)
   04310 Wnt signaling pathway
    102988128 (MYC)
   04350 TGF-beta signaling pathway
    102988128 (MYC)
   04390 Hippo signaling pathway
    102988128 (MYC)
   04630 JAK-STAT signaling pathway
    102988128 (MYC)
   04151 PI3K-Akt signaling pathway
    102988128 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102988128 (MYC)
   04218 Cellular senescence
    102988128 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102988128 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102988128 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102988128 (MYC)
   05202 Transcriptional misregulation in cancer
    102988128 (MYC)
   05206 MicroRNAs in cancer
    102988128 (MYC)
   05205 Proteoglycans in cancer
    102988128 (MYC)
   05230 Central carbon metabolism in cancer
    102988128 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102988128 (MYC)
   05225 Hepatocellular carcinoma
    102988128 (MYC)
   05226 Gastric cancer
    102988128 (MYC)
   05216 Thyroid cancer
    102988128 (MYC)
   05221 Acute myeloid leukemia
    102988128 (MYC)
   05220 Chronic myeloid leukemia
    102988128 (MYC)
   05219 Bladder cancer
    102988128 (MYC)
   05213 Endometrial cancer
    102988128 (MYC)
   05224 Breast cancer
    102988128 (MYC)
   05222 Small cell lung cancer
    102988128 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102988128 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102988128 (MYC)
   05161 Hepatitis B
    102988128 (MYC)
   05160 Hepatitis C
    102988128 (MYC)
   05163 Human cytomegalovirus infection
    102988128 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102988128 (MYC)
   05169 Epstein-Barr virus infection
    102988128 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102988128 (MYC)
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102988128 (MYC)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    102988128 (MYC)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     102988128 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH
Other DBs
NCBI-GeneID: 102988128
NCBI-ProteinID: XP_007103979
UniProt: A0A2Y9EJZ9
LinkDB
Position
Unknown
AA seq 439 aa
MPLNVSFANRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVASFSPRGDDDGGGGSFSSADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPSPARGHGGCSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSSPKPCASPDSTAFSPSSDSLLSSAASSPRASPEPLAL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQPPAKRSESGSPSAGGHSKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDCPAAKRAKLDSGRVLKQISNNRKCASPRSSDTEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSVQAEEQKLISEKDEL
RKRREQLKLKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgtcagcttcgccaacaggaactatgacctcgactacgactcggtgcag
ccttatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagccgcctgcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtccccgagccgccgctccgggctctgctcgccctcgtacgtcgcggtcgcgtccttc
tcccccaggggagacgacgacggcggcggcggcagcttctcctcggcggaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagcttcatctgcgaccccgac
gatgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcggagaagctggcctcttaccaggctgcgcgcaaagacagcggc
agcccgagccccgcccgcgggcacggcggctgctccacctccagcttgtacctgcaggac
ctgagcgccgccgcctccgaatgcatcgacccgtccgtggtcttcccctacccgctcaac
gacagcagctcgcccaagccgtgcgcctcccccgactccaccgccttctcgccgtcctcg
gactctctgctctcctccgccgcgtcctccccgcgggccagtcccgagcccctggcgctc
cacgaggagacaccacccaccaccagcagcgactctgaggaagaacaagaggatgaggaa
gaaattgatgttgtttctgtggaaaagaggcagccccctgccaaaaggtcagaatcgggg
tcaccctctgccggaggccacagcaaacctcctcacagcccgttggtccttaagagatgc
cacgtgtccacccatcaacacaattatgcagcgcccccctccactaggaaggactgtccc
gccgccaagagggctaagttggacagtggcagggtcctgaaacagatcagcaacaatcgc
aaatgtgccagccccaggtcttcggacaccgaggagaatgacaagagacggacacacaac
gtcttggaacgccagaggagaaacgagctgaaacgcagcttttttgcccttcgtgaccag
atcccggagttagaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca
gcatacatcctgtccgtccaagcagaggagcaaaagctcatttcagaaaaagacgagttg
cggaagaggcgagaacagttgaaactcaaacttgaacagctacggaactcttgcgcataa

DBGET integrated database retrieval system