KEGG   Physeter catodon (sperm whale): 102988182
Entry
102988182         CDS       T06011                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04151  PI3K-Akt signaling pathway
pcad04217  Necroptosis
pcad04380  Osteoclast differentiation
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04621  NOD-like receptor signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad05140  Leishmaniasis
pcad05145  Toxoplasmosis
pcad05152  Tuberculosis
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05171  Coronavirus disease - COVID-19
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05212  Pancreatic cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102988182 (JAK1)
   04151 PI3K-Akt signaling pathway
    102988182 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102988182 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102988182 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102988182 (JAK1)
   04658 Th1 and Th2 cell differentiation
    102988182 (JAK1)
   04659 Th17 cell differentiation
    102988182 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102988182 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102988182 (JAK1)
   05203 Viral carcinogenesis
    102988182 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102988182 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102988182 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    102988182 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102988182 (JAK1)
   05161 Hepatitis B
    102988182 (JAK1)
   05160 Hepatitis C
    102988182 (JAK1)
   05171 Coronavirus disease - COVID-19
    102988182 (JAK1)
   05164 Influenza A
    102988182 (JAK1)
   05162 Measles
    102988182 (JAK1)
   05168 Herpes simplex virus 1 infection
    102988182 (JAK1)
   05163 Human cytomegalovirus infection
    102988182 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102988182 (JAK1)
   05169 Epstein-Barr virus infection
    102988182 (JAK1)
   05165 Human papillomavirus infection
    102988182 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    102988182 (JAK1)
   05140 Leishmaniasis
    102988182 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102988182 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102988182 (JAK1)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102988182 (JAK1)
Protein kinases [BR:pcad01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102988182 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1
Other DBs
NCBI-GeneID: 102988182
NCBI-ProteinID: XP_023975359
UniProt: A0A2Y9SI10
LinkDB
Position
4
AA seq 1153 aa
MQYLNIKEDCNAMAFCAKMRSSKKTDVNLEAPEPGVEVLFYLSDREPLRLGGGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKMSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNSYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMMKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSMLLISSENEMN
LFHPNDNGNILCYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKHKKDEEKNKIR
EEWNNFSYFPEITHIVIKESVVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKSELLGVQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMGHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIMQGEHLGRGTRTHIYSGT
LTDYKDDEGTSEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKFKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGTDSECGPFIKLSDPGIPVTVLSRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLKQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPRNCPEEVYQLMRKCWEFQPSNRTT
FQNLIEGFEALLK
NT seq 3462 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgagg
agctccaagaagactgacgtgaatctggaggcccctgagccaggggtggaagtgctcttc
tatctgtcggatagggagcccctccggttgggcggcggagagtacacagcggaggagctg
tgcatcagggcggcacaggaatgctgtatatctcctctgtgtcacaacctctttgccctg
tatgatgagaacaccaagctctggtatgctccgaatcgcaccatcaccgtcgatgacaag
atgtcactccggctccactaccggatgaggttctatttcaccaactggcatgggaccaat
gataacgagcagtcagtatggcgacattctccaaagaagcagaagaacagctacgagaaa
aaaaaagtaccagatgcaacccctctccttgacgccagctcattggagtatctgtttgct
cagggacagtatgatttggtcaaatgcctggctcccattcgagaccccaagacagagcag
gatgggcatgatattgagaacgagtgtctgggaatggccgtcctggccatctcccactat
gctatgatgaagaagatgcagttgccagaacttcccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgcggata
aataatgttttcaaggatttcctaaaggagtttaacaacaagaccatttgtgacagcagt
gtgtccacacacgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccatgctactgatttcatcagaaaatgagatgaat
ctgttccatccgaatgataatggaaacattctctgctatgaagtgatggtgactggaaat
cttggaatccagtggaggcagaaaccaaatgttgttcctgttgaaaaggaaaaaaataaa
ctgaaacggaaaaaactggaaaataaacacaagaaggatgaggagaaaaacaaaatccgg
gaagagtggaacaatttttcttacttccctgagatcacgcacattgtaatcaaggagtct
gtggtcagcattaataagcaggacaacaaaaaaatggaactgaagctctcttcccacgaa
gaggccttgtcctttgtgtccctcgtggatggctacttccggctcacagcagatgcccat
cattacctctgcaccgacgtggctcccccgttgatcgtccacaacatacagaatggctgt
catggtccaatctgcacagagtatgccatcaataagttgcggcaagaaggaagcgaggag
ggaatgtatgtgctgcggtggagctgcaccgacttcgacaacatcctcatgaccgtcact
tgctttgaaaaatctgagttgctgggtgtccagaagcagttcaagaactttcagattgag
gtgcagaagggccgctacagcctgcatggctcggaccgaagcttccccagccttggagac
ctcatgggccacctgaagaagcagatcctgcgcacggacaacatcagctttgtgctgaag
cgctgctgccagcccaagccccgagaaatctccaatctgctggtggccacaaagaaagcc
caggagtggcagcctgtctaccccatgagccagctgagttttgatcggatcctcaagaaa
gatattatgcagggcgagcaccttgggagaggcacgcggacacacatctactctgggacc
ctcacggattacaaggatgacgaaggaacttccgaagagaagagaataaaagtgatcctc
aaagtcttagaccccagccacagggacatttctctggccttctttgaggcagccagcatg
atgagacaggtctcccataaacacatcgtgtacctctatggtgtttgtgtccgggatgtg
gagaatatcatggtggaagagtttgtggagggggggcccctggatctcttcatgcaccgg
aaaagtgatgtcctcaccacaccctggaagttcaaagttgccaaacagctggccagtgcc
ctgagttacttggaggataaagatctggtccacggaaacgtgtgcactaaaaacctcctc
ctggcccgcgagggcactgacagcgagtgcggccccttcatcaagctcagtgaccccggc
atccccgtcactgtgctgtccaggcaagagtgcatagaacgaatcccatggatcgctcct
gagtgtgttgaagactccaagaacctgagtgtggccgctgacaagtggagctttgggacc
acgctctgggagatctgctacaatggcgagatccccttgaaagacaagacactgattgag
aaagagagattctatgaaagccggtgcaggccagtgaccccgtcttgtaaggagctagct
gaccttatgacccgctgcatgaactacgaccccaaccagagacccttcttccgagccatc
atgagagacatcaataagctggaggagcagaatccagacatcgtatcagaaaaaaagcca
gcaactgaagtggatcccacacattttgaaaagcggttcttaaagaggatacgtgacttg
ggagagggccactttgggaaggtcgagctctgcaggtatgaccctgagggggacaataca
ggggagcaggtggccgtcaaatccctgaagcctgagagcggagggaaccacatagctgat
ctgaagaaggaaattgaaatcttaagaaacctttatcatgagaacattgtgaagtataaa
ggcatctgcacagaagacggaggaaatggtattaagctcatcatggaatttctgccttcg
ggaagtcttaaggagtatcttccaaagaataagaacaaaattaacctcaaacagcagtta
aaatatgccgttcagatttgtaaggggatggactatttgggttctcggcagtacgttcac
cgtgacttagcagcaagaaatgtccttgttgagagtgaacaccaagtgaaaattggggac
tttggtctaaccaaagccattgaaactgataaggagtactacacagtcaaggacgatcgg
gacagccctgtgttttggtatgctccagaatgtttaattcagtgtaagttttatatcgcc
tctgatgtctggtcttttggagtaactctgcatgagctgcttacttactgtgattcagat
tccagtcccatggcgttgttcctgaaaatgataggcccaactcatggccagatgacagta
acaagacttgtgaatacattaaaagaaggaaaacgtttgccttgtccacgtaactgtcca
gaagaggtttatcaacttatgagaaaatgctgggaattccaaccatccaatcggacaacc
tttcagaaccttattgagggatttgaagcgcttctaaaataa

DBGET integrated database retrieval system