KEGG   Physeter catodon (sperm whale): 102988252
Entry
102988252         CDS       T06011                                 

Gene name
CDH1
Definition
(RefSeq) cadherin-1
  KO
K05689  cadherin 1, type 1, E-cadherin
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04015  Rap1 signaling pathway
pcad04371  Apelin signaling pathway
pcad04390  Hippo signaling pathway
pcad04514  Cell adhesion molecules
pcad04520  Adherens junction
pcad05100  Bacterial invasion of epithelial cells
pcad05200  Pathways in cancer
pcad05213  Endometrial cancer
pcad05216  Thyroid cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    102988252 (CDH1)
   04390 Hippo signaling pathway
    102988252 (CDH1)
   04371 Apelin signaling pathway
    102988252 (CDH1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    102988252 (CDH1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    102988252 (CDH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102988252 (CDH1)
  09162 Cancer: specific types
   05226 Gastric cancer
    102988252 (CDH1)
   05216 Thyroid cancer
    102988252 (CDH1)
   05218 Melanoma
    102988252 (CDH1)
   05219 Bladder cancer
    102988252 (CDH1)
   05213 Endometrial cancer
    102988252 (CDH1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    102988252 (CDH1)
Chromosome and associated proteins [BR:pcad03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    102988252 (CDH1)
Cell adhesion molecules [BR:pcad04515]
 Cadherins
  Major cadherins
   102988252 (CDH1)
CD molecules [BR:pcad04090]
 Proteins
  102988252 (CDH1)
SSDB
Motif
Pfam: Cadherin Cadherin_C Cadherin_pro Cadherin_3
Other DBs
NCBI-GeneID: 102988252
NCBI-ProteinID: XP_007110828
UniProt: A0A2Y9EXB8
LinkDB
Position
17
AA seq 883 aa
MGPPCRNLSALLLLLQVSSWLCHEPEPCNPGFGAESYTFTVPRLRLERGRVLGRVSFEGC
TGLPRTVYVSDDTRFKVGTDGVVAVKRPLHLHHPEMSFLVHAWDFTRRKLSTKVTLKAVV
HHHRHHHHHDSPSGTQTEVLTFPSSHHGLRRQKRDWVIPPISCPENEKGPFPKALVQIKS
NREKETEVFYSITGQGADTPPLHVFIIERETGWLKVTEPLDREDIAQYILFSHAVSSNGQ
AIEEPMEIVITVTDQNDNKPEFTQEVFKGSVVEGALPGTSVMEVSATDADDDVNTYNAAI
AYTILSQEPVLPHNKMFTINRDTGVISVLTTGLDRESFPTYTLVVQAADLQGEGLSTTAT
AVITVTDANDNPPIFNPTTYVGSVLENEANVVITTLTVTDADVPNTPAWEAVYTILNDDE
KQFVVITDPVTNEGILKTAKGLDFEAKQQYILYVQVTNVASFEVTLPTSTATVTVDVIDV
NEAPIFMPPQKKVNVPEDFGLGLEITSYTAQEPDRFMEQKITYRIWRDAANWLEINPDTG
AISTRAELDRENVEHVKNSTYTALIIATDNGSPPATGTGTLLLFLDDVNDNGPIPEPRYM
DFCQRNPQPHIINIIDPDLPPNTSPFTAELTHGASVNWTIEYNDQEHESLIFKPKKTLEV
GDYKINLKLIDNQNKDQVTTLDVHVCDCEGVVSNCRQAGPSAQAGLQLPAILGILGGILA
FLILILLLLLLVRRRRVVKEPLLPPEEDTRDNIYYYDEEGGGEEDQDYDLSQLHRGLDAR
PEVTRNDVAPTLLSVPQYRPRPANPDEIGNFIDENLKAADSDPTAPPYDSLLVFDYEGSG
SEAASLSSLNSSESDQDQDYDYLNEWGSRFKKLADMYGGGEDD
NT seq 2652 nt   +upstreamnt  +downstreamnt
atgggccctccgtgccgcaacctctctgcgctcctgctgctgctgcaggtctcatcgtgg
ctctgccacgagccggagccctgcaatcccggctttggcgccgagagctacacgttcacc
gtgccccggcttcgcttggagagaggccgagtcctgggcagagtgagttttgaaggatgc
accggtctaccaaggacagtctatgtttctgatgacacccgattcaaagtgggcacagat
ggcgtggttgcagtcaaacggcctttacaccttcatcatccagagatgagctttctcgtc
catgcctgggacttcacccgcaggaagctctccaccaaagtgaccctgaaggcagtagtg
caccaccatcgccaccaccatcatcatgactctccctctggaacccagacagaagtgctc
acatttcccagctcccaccatggtctcaggagacagaagagagactgggttattcctcct
atcagctgcccagaaaatgagaaaggcccgtttcctaaggctctggttcagatcaaatct
aacagggaaaaagaaaccgaagttttctacagcatcactggccaaggagccgacacaccc
cctcttcatgtgtttattattgaaagagaaacaggatggctaaaggtgacggagcctctg
gatagagaagacattgcccagtacattctcttctctcatgctgtgtcttcaaacgggcaa
gcaatcgaggagccgatggagattgtgatcaccgtgactgatcagaatgacaacaagcct
gagttcacccaggaggtcttcaaggggtctgtcgtggagggcgctcttccagggacctct
gtgatggaggtctcggccacagacgcagacgatgatgtgaacacctacaacgctgccatt
gcttacaccatcctcagccaagagcctgtgctgccacacaacaaaatgttcaccatcaac
agggacacgggtgtcatcagtgtgctcaccaccggtctggaccgggagagttttcccaca
tataccctggtggttcaagctgcagacctgcaaggtgaaggcttaagcacaaccgcaaca
gctgtgatcacagtcactgacgccaacgataaccctcccatcttcaacccaaccacgtac
gtggggtcggtgcttgagaacgaggctaacgtggtcatcaccacactcacagtgaccgat
gccgacgtccccaataccccagcgtgggaggccgtttacacaatattaaacgatgacgag
aagcagtttgttgtcatcacagacccagtaaccaatgaaggcattttgaagacggctaag
ggcttggattttgaggccaagcagcagtacatcctgtatgtgcaagtgactaatgtggcc
tcctttgaggtcactctccccacttccacagccactgtcaccgtggacgtgatagatgtg
aatgaagcccccattttcatgcctcctcagaagaaagtgaatgtgcccgaggacttcggc
ttgggcctggagatcacgtcctacaccgcccaggagccagacagatttatggaacagaag
atcacgtatcggatttggagggacgctgccaactggctggagattaatccggacacgggt
gccatttccactcgggctgagttggacagagagaacgtcgagcatgtgaagaacagcaca
tacacggccctcattatagccactgacaatggttctccacctgctactggaacgggaacc
ctgctcctattcctcgatgatgtgaatgacaatggccccataccagaacctcggtacatg
gacttctgccagaggaatccacagcctcatatcatcaacatcattgatcctgatcttccc
cccaacacttctcccttcacagcagaactaacacatggggcaagtgtcaactggaccatt
gagtacaatgaccaagaacatgaatctctgatttttaagccaaagaaaaccctagaggtg
ggtgactacaaaatcaatctcaagctcatagacaaccagaacaaagaccaagtgaccacc
ttagatgtgcacgtgtgtgactgtgaaggggtcgtcagcaactgtaggcaggccgggcct
tccgcccaagcaggattgcaacttcccgccattctggggattcttggaggcattcttgct
tttctgatcctgattctgctgcttctgctacttgttcggaggagaagggtagtcaaagag
cccttactgcccccagaagaagatacccgggacaacatttattactatgatgaagaagga
ggtggagaagaagaccaggactatgacctgagccagctacacaggggcctggatgctcgg
cccgaagtgactcgcaatgatgtggctccaaccctcctgagtgtgccccagtatcgaccc
cgacctgccaatcctgatgaaattggaaactttattgatgaaaacctgaaggcagctgac
agtgaccccacggccccaccctatgactctttgctggtgtttgattatgaaggaagcggt
tccgaagctgctagtctgagctccctgaactcctcggagtcagaccaagaccaggactat
gactacctgaacgaatggggcagtcgcttcaagaagttggcagacatgtatggaggcggc
gaggacgactag

DBGET integrated database retrieval system