KEGG   Physeter catodon (sperm whale): 102989193
Entry
102989193         CDS       T06011                                 

Gene name
RAD51
Definition
(RefSeq) DNA repair protein RAD51 homolog 1
  KO
K04482  DNA repair protein RAD51
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad03440  Homologous recombination
pcad03460  Fanconi anemia pathway
pcad05200  Pathways in cancer
pcad05212  Pancreatic cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    102989193 (RAD51)
   03460 Fanconi anemia pathway
    102989193 (RAD51)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102989193 (RAD51)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102989193 (RAD51)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    102989193 (RAD51)
   04121 Ubiquitin system [BR:pcad04121]
    102989193 (RAD51)
   03400 DNA repair and recombination proteins [BR:pcad03400]
    102989193 (RAD51)
Membrane trafficking [BR:pcad04131]
 Protein recycling
  Rab GTPases and associated proteins
   Other Rab GTPase associated proteins
    102989193 (RAD51)
Ubiquitin system [BR:pcad04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   BRCC complex
    102989193 (RAD51)
DNA repair and recombination proteins [BR:pcad03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    BRCA complex
     102989193 (RAD51)
    RecA family proteins
     102989193 (RAD51)
   FA (Fanconi anemia) pathway
    Other FA pathway factors
     102989193 (RAD51)
SSDB
Motif
Pfam: Rad51 AAA_25 RecA HHH_5 ATPase ssDNA_TraI_N HHH
Other DBs
NCBI-GeneID: 102989193
NCBI-ProteinID: XP_023971679
UniProt: A0A2Y9S745
LinkDB
Position
11
AA seq 339 aa
MAMQMQLEANADTSVEEESFGPQPISRLEQCGIHANDVKKLEEAGFHTVEAVAYAPKKEL
INIKGISEAKADKILTEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
SITEMFGEFRTGKTQICHTLAVTCQLPIDQGGGEGKAMYIDTEGTFRPERLLAVAERYGL
SGSDVLDNVAYARGFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD
NT seq 1020 nt   +upstreamnt  +downstreamnt
atggctatgcagatgcagcttgaagcaaatgcagatacttcagtggaagaagagagcttt
ggcccacaacctatttctcgattagagcaatgtggcatacatgccaatgatgtgaagaaa
ttggaagaagctggattccatactgtggaggctgttgcctatgcaccaaagaaggagcta
ataaatattaaggggattagtgaagccaaagctgataaaattctgactgaggcagctaaa
ttagttccaatgggtttcaccactgcaactgagttccaccaaaggcggtctgagatcata
cagattactaccggctccaaagagcttgacaaactacttcaaggaggaattgagactgga
tccatcacagagatgtttggagaattccgaaccgggaagacccagatctgtcatacgttg
gctgtaacatgccagcttcccattgaccaaggtggaggtgaaggaaaggccatgtacatt
gacaccgagggtacctttagaccagaacggctgttagcagtggctgagagatatggcctc
tctggcagtgatgtcctggataatgtagcatatgctcgagggttcaacacagaccaccag
acccagctcctttatcaagcatcagccatgatggtagagtccaggtatgcactgctaatt
gtagacagtgccaccgccctctacagaacagactattcgggtcgaggtgagctttcagcc
aggcagatgcacttggccaggtttctgcggatgcttctgcgacttgctgatgagtttggt
gtagcagtggtaatcaccaaccaggtggtagcccaagtggatggagcagccatgtttgct
gcagatcctaaaaaacctattggaggaaatatcattgctcatgcctcaacaacaagactg
tacctgagaaaaggaagaggggaaaccagaatctgcaaaatctatgactctccttgtctt
cctgaagctgaagctatgtttgccatcaatgcggatggagtaggagatgccaaggactga

DBGET integrated database retrieval system