KEGG   Physeter catodon (sperm whale): 102989784
Entry
102989784         CDS       T06011                                 

Gene name
CACNA1C
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1C isoform X1
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04020  Calcium signaling pathway
pcad04022  cGMP-PKG signaling pathway
pcad04024  cAMP signaling pathway
pcad04260  Cardiac muscle contraction
pcad04261  Adrenergic signaling in cardiomyocytes
pcad04270  Vascular smooth muscle contraction
pcad04713  Circadian entrainment
pcad04720  Long-term potentiation
pcad04723  Retrograde endocannabinoid signaling
pcad04724  Glutamatergic synapse
pcad04725  Cholinergic synapse
pcad04726  Serotonergic synapse
pcad04727  GABAergic synapse
pcad04728  Dopaminergic synapse
pcad04742  Taste transduction
pcad04911  Insulin secretion
pcad04912  GnRH signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04924  Renin secretion
pcad04925  Aldosterone synthesis and secretion
pcad04927  Cortisol synthesis and secretion
pcad04929  GnRH secretion
pcad04930  Type II diabetes mellitus
pcad04934  Cushing syndrome
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05020  Prion disease
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05031  Amphetamine addiction
pcad05410  Hypertrophic cardiomyopathy
pcad05412  Arrhythmogenic right ventricular cardiomyopathy
pcad05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102989784 (CACNA1C)
   04020 Calcium signaling pathway
    102989784 (CACNA1C)
   04024 cAMP signaling pathway
    102989784 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    102989784 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    102989784 (CACNA1C)
   04929 GnRH secretion
    102989784 (CACNA1C)
   04912 GnRH signaling pathway
    102989784 (CACNA1C)
   04921 Oxytocin signaling pathway
    102989784 (CACNA1C)
   04935 Growth hormone synthesis, secretion and action
    102989784 (CACNA1C)
   04924 Renin secretion
    102989784 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    102989784 (CACNA1C)
   04927 Cortisol synthesis and secretion
    102989784 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102989784 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    102989784 (CACNA1C)
   04270 Vascular smooth muscle contraction
    102989784 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    102989784 (CACNA1C)
   04727 GABAergic synapse
    102989784 (CACNA1C)
   04725 Cholinergic synapse
    102989784 (CACNA1C)
   04728 Dopaminergic synapse
    102989784 (CACNA1C)
   04726 Serotonergic synapse
    102989784 (CACNA1C)
   04720 Long-term potentiation
    102989784 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    102989784 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    102989784 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    102989784 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102989784 (CACNA1C)
   05020 Prion disease
    102989784 (CACNA1C)
   05022 Pathways of neurodegeneration - multiple diseases
    102989784 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    102989784 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    102989784 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    102989784 (CACNA1C)
   05414 Dilated cardiomyopathy
    102989784 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102989784 (CACNA1C)
   04934 Cushing syndrome
    102989784 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:pcad04040]
    102989784 (CACNA1C)
Ion channels [BR:pcad04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   102989784 (CACNA1C)
SSDB
Motif
Pfam: Ion_trans CAC1F_C GPHH Ca_chan_IQ PKD_channel DUF4834
Other DBs
NCBI-GeneID: 102989784
NCBI-ProteinID: XP_023984736
UniProt: A0A2Y9T1D3
LinkDB
Position
6
AA seq 2140 aa
MVNENTRMYIPEENHQGPSYGSPRRAHADVNANAAAGLAPEHIPTPGAALSWQAAIDAAR
RARLMGSAGDAAISTVSSTRRKRQQHGKPKKQGGALATRPPRALLCLTLGNPIRRACIGI
VEWKPFEIIILLTIFANCVALAIYIPFPEDDSNATNSNLERVEYLFLIIFTVEAFLKVIA
YGLLFHPNAYLRNGWNLLDFIIVVVGLFSAILEQATKADGANALGGKGAGFDVKALRAFR
VLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFMGKMHKTCYN
QEGIADVPAEDDPSPCALETGHGRQCQNGTVCKPGWDGPKHGITNFDNFAFAMLTVFQCI
TMEGWTDVLYWVNDAVGRDWPWIYFVTLIIIGSFFVLNLVLGVLSGEFSKEREKAKARGD
FQKLREKQQLEEDLKGYLDWITQAEDIDPENEDEGLDEEKPRNMSMPTSETESVNTENVA
GGDIEGESCGARLAHRISKSKFSRYWRRWNRFCRRKCRAAVKSSIFYWLVIFLVFLNTLT
IASEHYSQPHWLTEVQDTANKALLALFTAEMLLKMYSLGLQAYFVSLFNRFDCFIVCGGI
LETILVETKIMSPLGISVLRCVRLLRIFKITRYWNSLSNLVASLLNSVRSIASLLLLLFL
FIIIFSLLGMQLFGGKFNFDEMQTRRSTFDNFPQSLLTVFQILTGEDWNSVMYDGIMAYG
GPSFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLADAESLTSAQKEEEEEKERKKLAR
TASPEKKQEVMERPAVEETKEEKIELKSITADGESPPATKINMDDLQPNESEDKSSYPNP
ETTGEEDEEEPEMPVGPRPRPLSELHLKEKAVPMPEASAFFIFSPSNRFRLQCHRIVNDS
VFTNLILFFILLSSISLAAEDPVQHTSFRNHILFYFDIVFTTIFTIEIALKMTAYGAFLH
KGSFCRNYFNILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQ
CVFVAIRTIGNIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYVTYKDGE
VDHPIIQPRSWENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRV
EISVFFIIYIIIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLR
RYIPKNQHQYKVWYVVNSTYFEYLMFVLILLNTICLAVQHHGQSCLFKIAMNVLNMLFTG
LFTVEMILKLVAFKPKHYFCDAWNTFDALIVVGSIVDIAITEVNPAEHTQCSPFMNAEEN
SRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIVMLFFIYAVIGMQ
VFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIMLACMPGKKCAPESEPGSS
AEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRI
WAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVSMNMPLNSDGTVMFNA
TLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLDQVVPPAGDDEVTVGKFYA
TFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDLGPEIRRAISGDLTAEEELD
KAMKEAVSAASEDDIFRRAGGLFGNHVRCSPSASRSAFPQTFTTQRPLHISKAGAGQGDA
ESPSHEKLVDSTFTPSSYSSMGSNANINNANNTALGRCPRPAGQPGAVSLSTVEARGPPL
SPAVQVQGASWRLSSKRCPSRDSQIAMVCQEEAPRGETCDLRMDEDAEYGSEPSLISTEM
LSYQDDENRQLAPAEEDRRDIHLSPKRGFLRSASLGRRASFHLECLKRQKNPGGDISQKT
VLPLHLVHHQALAVAGLSPLLQRSHPPGALPPPQATAPAAPGPAWPPWPVPTLRLERAES
SDKLTSSFPSVHCGPWAGEPTPCGASGGIRRARPVSLTVPSPAGPRGRPFHGSASSLVEA
VLISEGLGQFAQDPRFLEAATQELADACNLTIEEMESAADNILSGGARQSPNGTLLPCAN
CRDPGPDREGGAEDAARAPSPEPRQGGGEPRDSRAFASSL
NT seq 6423 nt   +upstreamnt  +downstreamnt
atggtcaatgaaaacacgaggatgtacattccggaggaaaaccaccaaggtcccagctat
gggagcccgcggcgggcccacgccgacgtgaacgccaacgcggccgcggggctggcgcct
gagcacatccccacgccgggggccgccctgtcctggcaggcggccatcgacgcggcccgg
cgggccaggctgatgggcagcgccggcgacgccgccatctccacggtgagctccacgcgg
cggaagcggcagcagcacgggaagcccaagaagcagggcggcgcgctggccacgcgcccg
ccccgggccctgctctgcctgaccctcgggaaccccatccggagggcgtgcatcggcatc
gtcgagtggaagccgtttgaaatcattatcttactgactatttttgccaactgcgtggcc
ttagccatctatattccctttccagaggacgactccaacgccaccaactccaacctggaa
cgggtggagtatctctttctcatcatttttactgtggaagcatttttaaaagtcatagcc
tatgggctcctctttcaccccaatgcttacctccgcaacggctggaacttgctggatttt
atcattgtggtcgtcgggcttttcagtgcaatcttagagcaagcgaccaaagccgacggg
gccaacgccctgggagggaagggggctggattcgacgtgaaggcgctcagggcgttccgc
gtgctgcggcccctgcggctggtgtccggggtcccgagtctccaggtggtcctgaactcc
atcatcaaggccatggtacccctgctacacatcgccctgctcgtgctcttcgttatcatc
atctacgccatcatcgggctggagctcttcatggggaagatgcacaagacctgctacaac
caggagggcatcgcagatgtcccagcagaagacgacccctccccctgtgccctggagacg
ggccacgggcggcagtgccagaacggcacggtgtgcaagccgggctgggatgggcccaag
cacggcatcaccaacttcgacaactttgctttcgccatgctgaccgtgttccagtgcatc
accatggagggctggaccgacgtcctctactgggtcaatgatgccgtgggaagggactgg
ccctggatctattttgttacactaatcatcatagggtcattttttgtacttaacttggtt
ctcggtgtccttagcggagagttttccaaagagagggagaaggccaaggcccggggcgac
ttccagaagctgcgggagaagcagcagctagaggaggacctgaagggctacctggactgg
atcacgcaggcggaggacatcgaccctgagaacgaggacgagggcttggacgaggagaaa
ccccgaaacatgagcatgcccaccagtgagaccgagtccgtcaacaccgaaaacgtggcc
ggaggtgacatcgagggagagagctgcggggccaggctggcccacaggatctccaagtcg
aagttcagccgctactggcgccggtggaatcggttctgcaggcggaaatgccgcgcggcc
gtgaagtcgagcatcttctactggcttgtcatcttcctggttttcctcaacacgctcacc
atcgcctctgagcactacagtcagccccactggctcacggaagtccaagacacggccaac
aaggccctgctggccctgttcacggcggagatgctgctcaagatgtacagcctggggctg
caggcctacttcgtgtccctcttcaaccgcttcgactgcttcatcgtatgcggcggcatc
ctggagaccatcctggtggagaccaagatcatgtcgcccctgggcatctccgtgctgaga
tgcgtacgcctcctgaggatatttaagatcacgaggtactggaactccctgagcaacctg
gtggcgtccctgctgaactctgtgcgctccatcgcctccctgctgctgcttctcttcctc
ttcatcatcatcttctccctcctgggcatgcagctgttcggggggaagttcaacttcgat
gagatgcagacccggaggagtacgttcgataacttcccccagtccctgctcaccgtgttt
cagatcctgaccggggaggactggaattcggtgatgtatgatgggatcatggcttatggc
ggcccctcttttccagggatgttagtctgtatttacttcatcatcctcttcatctgtgga
aattatatcctactgaatgtgttcttggccattgccgtggacaacctggctgacgccgag
agcctcacctctgcccagaaggaggaggaagaagagaaggagaggaagaagctggccagg
actgccagcccagagaagaaacaagaggtgatggagaggccggccgtggaggagaccaag
gaggagaaaatcgagctgaaatccatcactgcggatggagagtccccccctgccaccaag
atcaacatggacgacctccagcccaacgagagtgaggacaagagttcctaccccaacccg
gaaaccacaggagaagaggatgaggaggagcctgagatgcccgtgggcccccgcccacgc
cccctctcggagctgcacctgaaggagaaggcagtgcccatgccagaagccagcgccttc
ttcatcttcagcccaagcaacaggttccgtctccagtgccaccgcatcgtcaacgactcc
gtcttcaccaacctgatcctcttcttcatcctgctcagcagcatctccctggctgccgag
gaccccgtccagcacacctccttcaggaaccacattctgttttattttgacattgttttc
actaccattttcaccattgaaattgctctgaagatgaccgcctacggcgccttcctgcac
aagggctccttctgccgcaactacttcaacatcctggacctgctggtggtcagcgtgtcc
ctcatctccttcggcatccagtccagtgccatcaacgtggtgaagatcttgcgagtcctg
cgggtgctcaggcccctgagggccatcaacagggccaaggggctgaagcacgtggtgcag
tgcgtgttcgtggccatccgcaccatcgggaacatcgtcatcgtcaccacgctgctccag
ttcatgttcgcctgcatcggggtccagctcttcaagggcaagctctacacctgttcggac
agttccaaacagacggaggccgaatgcaaggggaactacgtcacatacaaggacggggag
gtggatcaccccatcatccagccgcgcagctgggagaacagcaagtttgactttgacaac
gtcctggcggctatgatggccctgttcaccgtctccacctttgaggggtggccggagctg
ctgtaccgctccatcgactcccacacggaggacaagggccccatttacaactaccgcgtg
gagatctccgtcttcttcatcatctacatcatcatcatcgccttcttcatgatgaacatc
ttcgtgggcttcgtcatcgtcaccttccaggagcagggggagcaggagtacaagaactgc
gagctggacaagaaccagcggcagtgcgtggagtacgcgctcaaggcccggcccctgcgg
aggtacatccccaagaaccagcaccagtacaaggtgtggtacgtggtcaactccacctac
ttcgagtacctgatgttcgtcctcatcctgctcaacaccatctgcctggccgtgcagcac
cacggtcagagctgcctgttcaaaatcgccatgaacgtcctcaacatgctcttcaccggc
ctcttcacggtggagatgattctgaagctcgtcgccttcaagcccaagcactatttctgt
gatgcatggaacacatttgacgccttgattgttgtgggtagcattgttgatatagccatc
accgaggtaaacccagctgaacatacccaatgctctccctttatgaacgcggaggagaac
tcccgcatctccatcaccttcttccgcctcttccgggtcatgcgtctggtcaagctgctg
agccgtggggagggcatccggacgctgctgtggacgttcatcaagtccttccaggccctg
ccctacgttgccctcctgatcgtgatgctgttcttcatctacgccgtgatcggaatgcag
gtgttcgggaaaatcgccctcaatgacacgacggagatcaacaggaacaacaacttccag
accttcccccaggccgtgctgctcctgttcaggtgcgccaccggggaggcgtggcaggac
atcatgctggcctgcatgccaggcaagaagtgcgcccccgagtcggaaccgggcagcagc
gctgagggggagacgccctgcggcagcagcttcgctgtcttctacttcatcagcttctac
atgctctgcgcctttctgatcatcaacctcttcgtagccgtcatcatggacaactttgac
tacctgacgagggactggtccatcctgggtccccaccacctggacgaatttaagagaatc
tgggcggagtatgatcctgaagccaagggtcgcatcaaacacctggacgtggtgaccctg
ctccggagaattcagcccccgctgggctttgggaagctgtgccctcaccgcgtggcttgc
aaacgcctggtctccatgaacatgcccctgaacagcgacgggaccgtcatgttcaacgcc
accctgtttgccctggtccggacggccctgaggatcaaaacggaagggaacctggaacag
gccaacgaggagctgcgggccatcatcaagaagatctggaagcggaccagcatgaagctg
ctggaccaggtggtgccgcctgcgggagatgatgaggtcacggtgggcaagttttacgct
actttcctgatccaagagtatttccggaaattcaagaagcgcaaagagcagggcctggtg
ggcaagccctcccagaggaacgccctgtccctgcaggctggtctgcgcaccctgcatgac
ctcgggcccgagatccgccgggccatctccggggacctgaccgccgaggaggagctggac
aaggccatgaaggaggctgtgtccgcggcctcggaagacgacatcttcaggagggccggc
ggccttttcggcaaccacgtgcgctgctcccccagcgccagccggagtgccttcccccag
accttcaccacccagcgtcctctgcacatcagcaaggcgggcgccggccagggtgacgcg
gagtcgccctcccacgagaaactggtggactccaccttcacgcccagcagctactcgtcc
atgggttccaacgccaacatcaacaacgccaacaacaccgccctgggccgctgcccccgc
cctgccggccagcccggcgctgtcagcctcagcaccgtggaggcccgtgggccccccttg
tcccccgctgtccaggtgcagggggcctcgtggaggctcagctccaagaggtgcccctcc
cgggacagccagatagccatggtgtgtcaggaggaggcccctcggggcgagacttgtgac
ctgaggatggatgaggacgccgagtacggcagcgagcccagcctgatctccacggagatg
ctctcctaccaggacgacgagaatcggcagctggcgcccgccgaggaggacaggagagac
atccatctgtctccgaagaggggcttcctgcgctccgcctccctaggtcgaagggcctcc
ttccacctggagtgtctgaagcgacagaagaatccagggggagacatctctcagaagaca
gtcctgcccctgcatctcgttcaccatcaggcgctggcggtggcgggcctgagccccctc
ctgcagagaagccatccccctggcgccctccccccgccgcaggccacggcccctgccgcg
cccggcccggcctggcccccgtggcctgtgcccaccctgcggctggagagggccgagtcc
agcgacaagctcaccagcagcttcccgtccgtccactgcggcccctgggccggggagccc
acgccctgtggggccagcggcggcatccggagggcgcggcccgtgtccctcaccgtgccc
agcccggcggggccccggggccggcccttccacggcagcgccagcagcctggtggaggcg
gtcttgatctcggaaggactggggcagtttgctcaggatcccaggttcctcgaggccgcc
acccaggagctggccgacgcctgcaacctgaccatcgaggagatggagagcgcggccgac
aacatcctcagcgggggtgcccggcagagccccaacggtaccctgctcccgtgtgcaaac
tgcagggacccggggccagaccgagaggggggcgcggaggacgcggcccgggcgcccagc
cccgagccccgccagggcggaggggagccccgggacagcagggccttcgccagcagcctg
tag

DBGET integrated database retrieval system