KEGG   Physeter catodon (sperm whale): 102990026
Entry
102990026         CDS       T06011                                 

Gene name
JAK3
Definition
(RefSeq) tyrosine-protein kinase JAK3
  KO
K11218  Janus kinase 3 [EC:2.7.10.2]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04062  Chemokine signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04217  Necroptosis
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04630  JAK-STAT signaling pathway
pcad04658  Th1 and Th2 cell differentiation
pcad04659  Th17 cell differentiation
pcad05161  Hepatitis B
pcad05162  Measles
pcad05166  Human T-cell leukemia virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05223  Non-small cell lung cancer
pcad05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102990026 (JAK3)
   04151 PI3K-Akt signaling pathway
    102990026 (JAK3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    102990026 (JAK3)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    102990026 (JAK3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102990026 (JAK3)
   04659 Th17 cell differentiation
    102990026 (JAK3)
   04062 Chemokine signaling pathway
    102990026 (JAK3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990026 (JAK3)
   05203 Viral carcinogenesis
    102990026 (JAK3)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102990026 (JAK3)
  09163 Immune disease
   05340 Primary immunodeficiency
    102990026 (JAK3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102990026 (JAK3)
   05161 Hepatitis B
    102990026 (JAK3)
   05162 Measles
    102990026 (JAK3)
   05169 Epstein-Barr virus infection
    102990026 (JAK3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102990026 (JAK3)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     102990026 (JAK3)
Protein kinases [BR:pcad01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   102990026 (JAK3)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 FERM_F1 Jak1_Phl APH SH2
Other DBs
NCBI-GeneID: 102990026
NCBI-ProteinID: XP_007116963
UniProt: A0A2Y9F7X6
LinkDB
Position
Unknown
AA seq 1104 aa
MAPPSEETPLIPQRSCSLSSSEAGALHVLLPPRGPGPPQCLSFSFGDHSAEELCVWAAKA
CGILPVYHSLFALALEDLSCWFPPSHIFSVEDAGTQVLVYRLRFYFPNWFGLEKCHRFGL
RKNLASAILDLPVLEHLFAQHRNDLVSGRLPMGLSLKEQGECLSLAVLDLAQMALDQGQR
PEELLKTISYKVCLPPGLRDLIQGLSFVTRRRIRRTVRRALRRLAACQTDKHSLMAKYIM
DLERLDPDRATETFRVGLPGAAGGQDAQGQLRVAGGSGIAWSPGEHEVLQPFCDFPEIVD
ISIKQAPRIGPAGEHRLVTITRTDNQILEAEFPGLPAALSFVALVDGYFRLTTDSGHYFC
KEVAPPRLLEQVAEQCHGPITLDFAINKLKTGGSLPGSYVLRRSPQDFDSYLLTVCVATP
LGPDYKGCLIRCDPTGTFSLAGLGHPHSSLRELLAAYWDGGLHVDGVELNLTFCCTPRPK
EKSNLIVVRRDCNPPTSSPVQPQSQCQLSQMTFHKIPADSLEWHENLGHGSFTKIYRGCR
HEVVDGEARETEVLLKVMDAKHKNCMESFLEAATLMSQVSYQHLVLLHGVCMAGDSIMVQ
EFVYLGALDTYLRKCGQLVPASWKLQVIKQLAYALNYLEDKGLPHGNVSARKVLLAREGT
DGNLPFIKLSDPGVSPTVLSLEMLTDRIPWVAPECLQEARTLGLEADKWGFGATVWEVFS
GVTMPISTLDPAKKLQFYQERQQLPAPKWMELALLIQQCMAYEPGQRPSFRAVIRDLNSL
ITSDYELLSDPTPGALVPHDGLWNGAQLYACQDPTIFEERHLKYISQLGKGNFGSVELCR
YDPLGDNTGALVAVKQLQHSGPEQQRDFQREIQILKALHSDFIVKYRGVSYGPGRLSLRL
VMEYLPSGCLRDFLQRYRARLDAGRLLLYASQICKGMEYLGSRRCVHRDLAARNILVESE
THVKIADFGLAKLLPLDKDYYVVREPGQSPIFWYAPESLSDNIFSRQSDVWSFGVVLYEL
FTYSDKSCSPSAEFLRMMGCARDVPALCRLLELLADGQRLPAPPACPGEVHELMKLCWAP
SPQDRPPFSTLGPQLDALWSGSQG
NT seq 3315 nt   +upstreamnt  +downstreamnt
atggcacctccaagtgaggagacgcccctgatccctcagcgctcctgcagcctctcctct
tcagaggctggtgccctgcacgtgctgctgccccctcggggccctggacccccgcagtgc
ctatccttctcctttggggaccactcagctgaagagctatgtgtttgggctgctaaggcc
tgtggcatcctgcccgtgtaccactccctctttgctctggccttggaggacctgtcctgt
tggttccccccgagccacatcttctccgtggaggacgcgggcacccaggtccttgtctac
aggctccgcttttacttccccaactggtttgggctagagaagtgccaccgctttgggcta
cgaaagaacttagccagtgccatccttgacctgccagtcctggagcacctctttgcccag
caccgcaatgacctggtcagcggccgcctcccgatgggcctcagcctcaaggagcagggt
gagtgtctcagcttggctgtgctggacctggcccagatggccctcgaccagggtcagcgg
cccgaggagctgctgaagaccatcagctacaaggtctgcctgccccctggcctgcgcgac
ctgatccagggcctgagcttcgtgacgcgaaggcgtatccgaaggacagtgcgccgggcc
ttgcgccgcttggccgcctgccagactgataagcactcgctcatggccaagtacatcatg
gacctcgagcggctggacccagacagggccaccgagaccttccgcgtgggcctccccgga
gctgctggtggtcaggatgcgcaggggcagctccgcgtggctggcggcagtggcatcgcc
tggagcccgggagaacacgaggtcctccagcccttctgcgactttccagaaatcgtggat
atcagcatcaagcaggccccgcgcattggccccgccggggagcatcgcctggtcaccatc
accaggacagacaaccagatcctggaggccgagttcccggggctgcccgcagcgttgtcc
ttcgtggcgctcgtggatggctacttccggctgaccactgactccgggcactacttctgc
aaggaggtggcgcccccgcggctgctggagcaggtggctgagcagtgccatggccccatc
accttggattttgccatcaacaaactcaagactgggggttcacttcccggctcctacgtt
ctccgccgcagtccccaggatttcgacagctacctcctaactgtctgtgtcgcgaccccc
ctgggccctgattacaagggctgcctcatccggtgcgaccccacaggaaccttctccctg
gctggccttggccatccccacagcagtcttcgagagctcctggcagcctattgggatggt
gggttgcacgtggatggggttgagctgaacctcaccttctgctgcacccccagacccaaa
gaaaagtccaatctgattgtggtccggagagattgcaacccacccacatcatcccctgtt
cagccccaatcccaatgccagctgagtcagatgacatttcacaagatccctgctgacagc
ctggagtggcatgagaacctgggtcacgggtcctttaccaagatttaccggggctgtcgc
catgaggttgtggatggggaggcccgagagacagaggtgctgctcaaagtgatggatgcc
aagcacaagaactgcatggagtcattcctggaagcagcgaccttgatgagccaagtatcg
taccagcatctcgtgttgctccatggcgtgtgcatggctggagacagcataatggtgcag
gaatttgtatacctgggagcgctggacacatatctgcgcaagtgtggccagctggtgccg
gccagctggaagctacaggtgatcaaacagctggcttatgccctcaactatctggaagac
aaaggtctccctcacggcaatgtctcagcccggaaggtgctcctggctcgggaggggact
gacgggaacctgcctttcatcaagctgagtgaccccggtgtcagccccactgtgctaagc
ctggagatgctcactgacaggatcccctgggtggcccctgagtgtctccaggaggcccga
acacttggcttggaagctgacaagtggggctttggtgccacagtctgggaggtgttcagc
ggtgtcacaatgcccatcagcaccctggatcctgccaagaagctccagttttaccaggaa
cggcagcaactgcctgcacccaagtggatggagctggccctgctgatccaacagtgcatg
gcctatgagccaggccagaggccctctttccgcgctgtcatccgtgacctgaacagcctc
attacttcagattatgagctcctctcagaccccacacctggtgccctggtgccccatgat
gggctttggaatggggcccagctctatgcctgccaggaccctaccatctttgaggagaga
cacctcaagtacatctcacagctgggcaagggcaactttggcagtgtggaactgtgccgc
tatgacccgctgggcgacaacacaggtgccctggtggccgtgaagcagttgcagcacagc
gggccagaacagcagagggacttccagcgggagatccagatcctcaaagccctccacagt
gacttcattgtcaagtaccggggtgtcagctatggcccaggccgcctgagcctgcggctg
gtcatggagtacctgcccagcggctgcctgcgcgacttcctgcagcggtaccgcgcgcgc
cttgacgctggccgcctgctcctctacgcctcgcaaatctgcaagggcatggagtacctg
ggctcccgccgctgcgtgcaccgcgacctggcagcccgtaacatcctggtggagagcgag
acgcatgtcaaaatcgctgacttcggcctcgccaagctgctgccgctcgacaaagactac
tacgtggtccgcgagccaggccagagccccatcttctggtacgccccagagtccctctcg
gacaatatcttctcgcgccagtcagatgtctggagcttcggggtcgtcctgtacgagctc
ttcacctacagtgacaagagctgtagcccctcagccgagttcctgcggatgatgggatgt
gccagagatgtgccagccctctgccgcctcctggagctgctggccgacggccagaggctg
cccgcacctcctgcctgtcctggtgaggttcatgagctcatgaagctgtgctgggcccct
agcccacaagaccggccaccattcagcaccctgggcccccagctggatgcactgtggagt
ggaagccagggatag

DBGET integrated database retrieval system