KEGG   Physeter catodon (sperm whale): 102990192
Entry
102990192         CDS       T06011                                 

Gene name
ERBB2
Definition
(RefSeq) receptor tyrosine-protein kinase erbB-2 isoform X1
  KO
K05083  receptor tyrosine-protein kinase erbB-2 [EC:2.7.10.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04020  Calcium signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04520  Adherens junction
pcad04530  Tight junction
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05215  Prostate cancer
pcad05219  Bladder cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102990192 (ERBB2)
   04012 ErbB signaling pathway
    102990192 (ERBB2)
   04066 HIF-1 signaling pathway
    102990192 (ERBB2)
   04020 Calcium signaling pathway
    102990192 (ERBB2)
   04151 PI3K-Akt signaling pathway
    102990192 (ERBB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102990192 (ERBB2)
   04520 Adherens junction
    102990192 (ERBB2)
   04530 Tight junction
    102990192 (ERBB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102990192 (ERBB2)
   05206 MicroRNAs in cancer
    102990192 (ERBB2)
   05205 Proteoglycans in cancer
    102990192 (ERBB2)
   05230 Central carbon metabolism in cancer
    102990192 (ERBB2)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102990192 (ERBB2)
   05226 Gastric cancer
    102990192 (ERBB2)
   05219 Bladder cancer
    102990192 (ERBB2)
   05215 Prostate cancer
    102990192 (ERBB2)
   05213 Endometrial cancer
    102990192 (ERBB2)
   05224 Breast cancer
    102990192 (ERBB2)
   05223 Non-small cell lung cancer
    102990192 (ERBB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102990192 (ERBB2)
   01524 Platinum drug resistance
    102990192 (ERBB2)
   01522 Endocrine resistance
    102990192 (ERBB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102990192 (ERBB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pcad04147]
    102990192 (ERBB2)
   04090 CD molecules [BR:pcad04090]
    102990192 (ERBB2)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102990192 (ERBB2)
Protein kinases [BR:pcad01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   102990192 (ERBB2)
Exosome [BR:pcad04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   102990192 (ERBB2)
CD molecules [BR:pcad04090]
 Proteins
  102990192 (ERBB2)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like CcmD
Other DBs
NCBI-GeneID: 102990192
NCBI-ProteinID: XP_007112599
UniProt: A0A2Y9F099
LinkDB
Position
Unknown
AA seq 1255 aa
MELAAWCRWGLLLALLPPGAAGTQVCTGTDMKLRLLASPETHLDMLRHLYQGCQVVQGNL
ELTYLPANASLSFLQEIQEVQGYVLIAHNRVSQVPLQRLRIVRGTQLFEDNYALAVLDNG
DLLESATPAARAAPGGLQDLQLRSLTEILKGGVLIQRNPQLCHQDTILWKDIFHKNNQLA
LMLIDTNRSRACPPCSPACKAPHCWGESSKDCQSLTRTVCASGCARCKGPQPTDCCHEQC
AAGCTGPKHSDCLACLHFNHSGICELHCPALVTYNTDTFESMPNPEGRYTFGASCVTACP
YNYLSTDVGSCTLVCPLNNQEVTAEDGTQRCEKCSKPCARVCYGLGMEHLREVRAVTSAN
IQEFAGCKKIFGSLAFLPESFEGDGASNTAPLQPEQLRVFESLEEITGYLYISAWPDSLP
DLHVFQNLRVIRGRVLHDGAYSLTLQGLGIRWLGLRSLRELGSGLALIHRNARLCFVHTV
PWDQLFRNPHQALLHSANRPEVECVGEGLACYPLCAHGHCWGPGPTQCVNCSQFLRGQRC
VEECRVLQGLPREYVKDRYCLPCHPECQPQNGSVTCFGSEADQCVACAHHKDPPFCVARC
PSGVKPDLSFMPIWKFPDEEGMCQPCPINCTHSCVDLDDKGCPAEQRASPVTSIIAAVVG
ILLVVVVGLVFGTLIKRRRQKIRKYTMRRLLQETELVEPLTPSGAMPNQAQMRILKETEL
RKVKVLGSGAFGTVYKGIWIPDGENVKIPVAIKVLRENTSPKANKEILDEAYVMAGVGSP
YVSRLLGICLTSTVQLVTQLMPYGCLLDHVREHRGRLGSQDLLNWCVQIAKGMSYLEDVR
LVHRDLAARNVLVKSPNHVKITDFGLARLLDIDETEYHADGGKVPIKWMALESILRRRFT
HQSDVWSYGVTVWELMTFGAKPYDGIPAREIPDLLEKGERLPQPPICTIDVYMIMVKCWM
IDSECRPRFRELVAEFSRMARDPQRFVVIQNEDLGPTSPLDSTFYRSLLEDDDMGDLVDA
EEYLVPQQGFFCPDPAPGSGGTAHRRHRSTSTRSGGGELTLGLEPSEEEPPRSPLAPSEG
AGSDVFDGDLGMGAAKGLQNLPQHDCSPLQRYSEDPTVPLPPETDGYVAPLTCSPQPEYV
NQPEVRPQPPSPLEGPQPPPRPAGSTLERPKTLSPGKNGVVKDIFAFGAAVENPEYLAPR
GRAGPPSHPSPAFSPAFDNLYYWDQDSSERGSPPSTFEGTPTAENPEYLGLDMPV
NT seq 3768 nt   +upstreamnt  +downstreamnt
atggagctggcggcctggtgccgctgggggctcctcctcgccctcctgccccccggagcc
gcgggcacccaagtgtgcaccggcacagacatgaagctgcggctgctggccagtcccgag
acccacctggacatgctccgccacctctaccagggctgtcaggtggttcagggtaacctg
gagctcacctacctgcccgctaacgccagcctctccttcctgcaggagatccaggaggtg
cagggctacgtgctcatcgctcacaaccgagtgagtcaggtccccctgcagaggctgcgg
atcgtgcgaggcacccagctgtttgaggacaactatgccctggccgtgctggacaatgga
gaccttctggaaagtgccacccctgctgcacgcgctgctccgggagggctgcaggacctg
cagctgcgaagcctcacagagatcctgaagggaggggtcttgatccagcggaaccctcag
ctctgccaccaggacacgattttgtggaaggacatcttccacaagaacaaccagctggcc
ctcatgttgatagacaccaaccgctcacgggcctgcccaccctgttctccagcttgtaaa
gctccccactgctggggagaaagttccaaggactgtcagagcttgacgcgaaccgtctgt
gccagcggctgtgcccgctgtaagggcccgcagcccaccgactgctgccacgagcaatgt
gctgccggctgcacgggccccaagcactctgactgtctggcctgcctccacttcaaccac
agtggcatctgtgagctgcactgcccagctctggtcacctacaacacggacaccttcgag
tccatgcccaaccccgagggccgttataccttcggcgccagctgcgtgaccgcctgtcct
tacaactacctgtctacggacgtgggatcctgcaccctggtttgtcccctgaacaaccaa
gaggtgacagctgaggatggaacccagcggtgtgagaaatgcagcaagccctgtgcccga
gtgtgctatggtctgggcatggaacacctgcgggaggtgagggcggtcaccagtgccaac
atccaggagtttgctggctgcaagaagatctttgggagcctggcgtttctgccggagagc
tttgagggggacggagcctccaacactgcccccctacagcctgagcagctcagagtattt
gagtctctggaggagatcacaggttacctgtacatctcagcgtggccagacagcctgccg
gacctccacgtcttccagaatctgcgagtaatccggggacgagttctgcatgatggtgcc
tactcgctgaccctgcaagggctgggcatccgctggctggggctgcgctcgctgcgggaa
ctgggcagtgggctggccctcatccaccgcaacgcccgcctctgctttgtacacacggtg
ccctgggaccagctcttccggaacccccaccaggccctgctccacagtgccaaccggcca
gaggtcgagtgcgtgggcgagggcctggcctgctacccgctgtgtgcccacgggcactgc
tggggtccagggcccacccagtgcgtcaactgcagccagttccttaggggccagcggtgc
gtggaagaatgccgagtactgcaggggctcccccgggagtacgtgaaggacaggtactgt
ctgccgtgccaccccgagtgtcagccccagaatggctcagtgacctgctttggctcggag
gccgaccagtgtgtggcttgcgcccaccacaaggatcctcccttctgcgtggctcgctgc
cccagcggtgtgaagcctgacctctccttcatgcccatctggaagttcccagatgaggag
ggcatgtgccagccatgccccatcaactgcacccactcctgtgtggacctggatgacaag
ggctgccccgccgagcagagagccagccctgtgacgtccatcattgccgccgtggtgggc
atcctgctggtcgttgtcgtggggctggtcttcggcaccctcatcaagcgaaggcggcag
aagatccggaagtacacgatgcggaggctgctgcaggagacagagctggtggagcccctg
acaccgagcggagcgatgccaaatcaggctcagatgcggatcctgaaagagacagagctg
aggaaggtgaaggtgcttggatccggagcttttggcaccgtctacaagggcatctggatc
cccgatggggaaaatgtgaaaatcccagtggccatcaaagtgttgagggaaaacacatcc
cccaaagccaacaaagaaatcttggacgaagcatatgtgatggctggtgtagggtcccca
tacgtgtcccgccttctgggcatctgcctgacatccacggtgcagctggtgacacagctt
atgccctatggctgcctcctagaccacgtccgggagcaccgcgggcgcctgggctcccag
gacctgctgaactggtgtgtgcagattgccaaggggatgagctacttggaggacgtgcgg
ctcgtgcacagggacctggctgcccggaatgtgctggtcaagagtcccaaccatgtcaag
attacagactttgggctggctcggctgctggacattgacgagacagagtaccacgcggat
gggggcaaggtgcccatcaagtggatggcgttggagtccattctccgccggcggttcacc
caccagagtgatgtgtggagctatggtgtgactgtgtgggagctgatgacttttggggcc
aaaccttacgatgggatcccagcccgggagatccctgacctcctggagaagggggaacgg
ctgccccagccccccatctgcaccattgatgtctacatgatcatggtcaaatgttggatg
attgactctgaatgtcggccgaggttccgggagttggtggccgaattctcccgcatggcc
agggacccccagcgctttgtggtcatccagaatgaagacttgggccctaccagccccttg
gacagcaccttctaccgctcactgctggaggatgatgacatgggggacctggtggatgct
gaggagtacctggtaccccagcaaggcttcttctgcccagaccctgccccaggctctggg
ggcacagcccaccgcaggcaccgcagcacatccaccaggagtggcggtggtgagctgacg
ctgggtctggagccctcggaggaggagccccccaggtctccactggcaccttccgaaggg
gctggctctgatgtgtttgacggcgacttgggaatgggggcagccaaggggctgcagaac
ctcccccaacatgactgcagccctctacagcggtacagcgaggaccccacagtaccgctt
cctcccgagaccgatggctacgtcgcccccctgacatgcagcccccagcccgaatacgtg
aaccagccagaggttcggccacagcccccctcacccctagagggtcctcagcctccccct
cgacctgccggttccactctggaaaggcccaagactctctcccctgggaagaatggggtt
gtcaaagacatttttgcctttggggctgctgtggagaaccccgagtacttggcaccccgg
ggcagggctggccctccgtcccacccttctccggccttcagcccagcctttgacaacctc
tattactgggaccaggactcatcagagcggggctctccacccagcacctttgaagggacc
cctacagcagagaaccccgagtacctgggtctggacatgccagtatga

DBGET integrated database retrieval system