KEGG   Physeter catodon (sperm whale): 102991092
Entry
102991092         CDS       T06011                                 

Gene name
BAK1
Definition
(RefSeq) bcl-2 homologous antagonist/killer
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01524  Platinum drug resistance
pcad04141  Protein processing in endoplasmic reticulum
pcad04210  Apoptosis
pcad04215  Apoptosis - multiple species
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05132  Salmonella infection
pcad05160  Hepatitis C
pcad05162  Measles
pcad05163  Human cytomegalovirus infection
pcad05164  Influenza A
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05218  Melanoma
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102991092 (BAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102991092 (BAK1)
   04215 Apoptosis - multiple species
    102991092 (BAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102991092 (BAK1)
   05202 Transcriptional misregulation in cancer
    102991092 (BAK1)
   05206 MicroRNAs in cancer
    102991092 (BAK1)
   05203 Viral carcinogenesis
    102991092 (BAK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102991092 (BAK1)
   05212 Pancreatic cancer
    102991092 (BAK1)
   05225 Hepatocellular carcinoma
    102991092 (BAK1)
   05226 Gastric cancer
    102991092 (BAK1)
   05214 Glioma
    102991092 (BAK1)
   05216 Thyroid cancer
    102991092 (BAK1)
   05220 Chronic myeloid leukemia
    102991092 (BAK1)
   05217 Basal cell carcinoma
    102991092 (BAK1)
   05218 Melanoma
    102991092 (BAK1)
   05213 Endometrial cancer
    102991092 (BAK1)
   05224 Breast cancer
    102991092 (BAK1)
   05222 Small cell lung cancer
    102991092 (BAK1)
   05223 Non-small cell lung cancer
    102991092 (BAK1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    102991092 (BAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    102991092 (BAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102991092 (BAK1)
   05160 Hepatitis C
    102991092 (BAK1)
   05164 Influenza A
    102991092 (BAK1)
   05162 Measles
    102991092 (BAK1)
   05168 Herpes simplex virus 1 infection
    102991092 (BAK1)
   05163 Human cytomegalovirus infection
    102991092 (BAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102991092 (BAK1)
   05169 Epstein-Barr virus infection
    102991092 (BAK1)
   05165 Human papillomavirus infection
    102991092 (BAK1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102991092 (BAK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pcad03029]
    102991092 (BAK1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcad02000]
    102991092 (BAK1)
Mitochondrial biogenesis [BR:pcad03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    102991092 (BAK1)
Transporters [BR:pcad02000]
 Other transporters
  Pores ion channels [TC:1]
   102991092 (BAK1)
SSDB
Motif
Pfam: Bcl-2 Bcl-2_3
Other DBs
NCBI-GeneID: 102991092
NCBI-ProteinID: XP_007128909
UniProt: A0A2Y9FR10
LinkDB
Position
18
AA seq 211 aa
MASGQGPGPPRQGCEEPDPSSTSEEQVARDTEEVFRSYVFYRHQQEQEAEGAAAPTDPEM
VTLPLEPSSTMGQVGHQLAIIGDDINRRYDSEFQAMLQHLQPTAENAYEYFTKIASSLFE
SGINWGRVVALLGFGYRLALHVYQRGLTGFLGQVTRFVADFMLHHCIARWIAQRGGWVAA
LDLGNGPIWNVLIVLAVVLLGQFVVRRFFKS
NT seq 636 nt   +upstreamnt  +downstreamnt
atggcatccggacaaggtccaggtcctcccaggcaggggtgcgaagaacctgacccctcc
tccacttcggaggaacaggtagcccgggacacggaggaggttttccgcagctacgtcttt
taccgccatcagcaggagcaggaggccgagggggcggccgcgcccactgacccagaaatg
gtcaccttgcccctagaacctagcagcaccatggggcaggtgggtcaccagctggccatc
atcggggatgacatcaaccggcgctacgactccgagttccaggccatgttgcagcacctg
cagccaacagcagagaacgcctatgagtatttcaccaagatcgcctcaagcctgtttgag
agcggcatcaactggggccgagtggtggctctactgggctttggctaccgcctggccctc
cacgtctaccagcgcggcctgactggcttcctgggccaggtgacccgcttcgtggccgac
ttcatgttgcatcactgcattgcccggtggatcgcacagaggggtggctgggtggcagcc
ctggacttgggaaacggccccatctggaatgtgctaatagttctggctgtggttttgttg
ggccagttcgtggtacgaagatttttcaagtcatga

DBGET integrated database retrieval system