KEGG   Physeter catodon (sperm whale): 102991442
Entry
102991442         CDS       T06011                                 

Gene name
TSC1
Definition
(RefSeq) hamartin isoform X2
  KO
K07206  tuberous sclerosis 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04072  Phospholipase D signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04211  Longevity regulating pathway
pcad04218  Cellular senescence
pcad04714  Thermogenesis
pcad04910  Insulin signaling pathway
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102991442 (TSC1)
   04151 PI3K-Akt signaling pathway
    102991442 (TSC1)
   04152 AMPK signaling pathway
    102991442 (TSC1)
   04150 mTOR signaling pathway
    102991442 (TSC1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102991442 (TSC1)
  09143 Cell growth and death
   04218 Cellular senescence
    102991442 (TSC1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102991442 (TSC1)
  09149 Aging
   04211 Longevity regulating pathway
    102991442 (TSC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    102991442 (TSC1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102991442 (TSC1)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102991442 (TSC1)
   05163 Human cytomegalovirus infection
    102991442 (TSC1)
   05165 Human papillomavirus infection
    102991442 (TSC1)
SSDB
Motif
Pfam: Hamartin
Other DBs
NCBI-GeneID: 102991442
NCBI-ProteinID: XP_007101538
UniProt: A0A2Y9EGR7
LinkDB
Position
13
AA seq 1165 aa
MAQQANIGELLSMLDSPMLSVRDDVTAVFKENLSSDRGPMLVNTLVDYYLETNSQPVLHI
LTTLQEPHDKHLLDKMNEYVGKAASRLSTLSLLGHVVRLQPSWKHKLSQAPLLPSLLKCL
KMDTDVIVLTTGVLVLITMLPMIPQSGKQHLHDFFDIFGRLSSWCLKKPGHVTEIYLVHL
HASVYALFHRLYGMYPCNFVSFLRSHYSMKENLETFEEVVKPMMEHVRIHPELVTGSKDH
ELDPRRWKRLETHDVVIECAKISLDPTEASYEDGYSVSHQISARFPHRSADVTASSYVDT
QNSYGSATSTPHSTSRLMLLNTPGQLPQTLSSLSTRLLTEPPQATLWSPSVVCGMTTPPT
SPGNVPPDLSHPYSKVFGTAGRKGTPLGTPATSPPPAPPCHSDDYVHISLPQAMATAPKK
EERADSARPCLHRQHHLPNDRGLEELPGSKGSVTLSDLPGFLGDLASEEDSIEKDKEEAA
ISKELSEITTADAEPLAPRGGFDSPFYRDSLPGCPRKTHSAVSSAQGTGANPEPLNSALD
RLGPDTPKQAFTPIDLPCGGAEESPAGDRERQASLESSILTPSPFKIPPPRGVGFGGGQP
PPYDHLFEVALPKTARHFVSKKTEGLLKKAKGNTEEDCTPSASPMEVLDRLIQQGADAHS
KELNRLSLPSKSVDWTHFGGSAPSDETRSLRNQLLLLHNQLLYERFKRQQHALRNRRLLR
KVIRAAALEEHNAAMKDQLKLQEKDIQIWKVSLQKEQARYSQLQEQRDTVVTQLHSQIRQ
LQHDREEFYNQSQELQTKLEDCRNMIAELRIELKKANSKVCHTELLLSQVSQKLSNSESV
QQQMEFLNRQLLVLGEVNELYLEQLQNKHSDTTKEVEMMKTAYRKELEKNRSHVLQQNQR
LDTAQKRILELESHLAKKDHLLLEQKKYLEDVKLQARGQLQAAESRYEAQKRITQVFELE
ILDLYGRLEKDGLLKKLEEEKTEAAEAAEERLDCCRDGCLDSVTGHNNEEASGPNGEAKP
PRPGGARGGGGSRGGGGSSGSGSELSTPEKPPNPRAAPLGSRWETAVGEPATGIPVTVGS
LPSSKSFLGMKARELFRNKSESQCDEDSLTSSSLSETLKTELGKDSGVEAKPPLNLDGPQ
PPPPKPDSVGQLRIMDYNEVQHEHS
NT seq 3498 nt   +upstreamnt  +downstreamnt
atggcccaacaagcaaatattggggagctcctctccatgttggattcccccatgctgagt
gtgcgtgatgatgtaacagctgtctttaaagagaacctcagttctgaccgtggtccgatg
cttgtgaacaccttggtggattattacctggaaaccaattctcagcctgtattgcacatc
ctgactaccttgcaagagccacatgataagcacctcttggacaaaatgaatgaatacgtg
ggcaaagctgcctctcggttatccaccctctcgttactgggccacgttgtgaggctgcag
ccatcttggaagcataagctctctcaagcacctcttttgccttctttactaaaatgtctc
aagatggacaccgatgtcattgtcctcacaacaggggtcttagtgttgataaccatgcta
ccaatgattccacagtcggggaaacagcaccttcatgatttctttgatatttttggccgt
ctttcgtcatggtgcctgaagaaaccaggccacgtaacggaaatctatctcgtccacctc
cacgccagcgtttacgctctcttccatcgcctgtatgggatgtacccttgcaactttgtc
tccttcctacgttctcactacagtatgaaggagaacctggagacttttgaagaggtggtc
aagccaatgatggagcatgtgcgaattcacccagaattagtgactggatccaaggaccat
gaactggaccctcgaaggtggaagagattagaaacacatgatgttgtcatagaatgtgcc
aaaatctctctggaccctacagaagcctcatatgaagatggctattctgtgtctcaccaa
atctcagcccgttttcctcatcgttcagccgatgtcaccgccagctcttatgttgacaca
cagaatagctatgggagtgctacttctacccctcactccacttctcggctgatgttgtta
aacacgccagggcagctacctcagactctgagttccctgtcgacacggctgttaactgag
ccgccacaagctactctttggagcccatctgtggtttgtgggatgaccactcctccaact
tctcctggaaatgtcccacccgatttgtcacacccttacagtaaagtctttggcacagcg
ggtagaaaaggaactcctctgggaacccctgcaacctctcctcctccagccccaccctgc
cattcggatgactacgtgcacatttcactcccgcaggccatggccacagcccccaagaag
gaagagagagcagattctgcaaggccctgtctacatagacaacaccatcttccgaatgac
agaggattagaagagctacctgggagcaaagggtctgtcactctcagtgatcttccaggg
tttttaggtgacctggcttctgaagaagatagtattgaaaaagataaagaagaagcggca
atatctaaagaactctctgagatcacaacagccgacgccgagcccctagctcctcgcgga
ggctttgactctcccttctaccgggacagtctcccgggctgcccgcggaagacccactca
gccgtctccagtgcccagggcaccggtgcgaaccctgagcctctgaactccgccctggac
aggctggggcctgacaccccaaagcaagcctttacccccatagacctgccctgcggaggc
gccgaggagagccctgccggggacagagagcgccaggcctctctggagagcagcatcctc
actcccagcccttttaaaattccacctccgaggggagtggggtttggcggtgggcagcct
cccccgtacgatcatctttttgaggtggcactgccaaagactgcccgtcattttgtcagc
aagaagacggagggactgctaaagaaagcaaaagggaacacagaggaggactgcacgccc
tcggcctcccccatggaagtgctggacagactgatacagcaaggggcagacgcgcacagc
aaggagctcaacaggttgtctttacccagcaagtctgtcgactggacccacttcggaggc
tccgctccctcagatgagacccgctccctccgtaaccagttgcttttactgcacaaccag
ttactctatgagcgttttaagaggcagcagcacgcgcttcggaacaggcggctcctgcgc
aaggtgatcagggcagctgctctggaggagcacaacgctgccatgaaagaccagttgaag
ttacaagagaaagacatccagatatggaaggttagtctgcagaaagaacaagccagatac
agtcagcttcaggagcagcgagacacggtggtcacccagctccacagccagatcagacag
cttcagcacgaccgggaggagttctacaaccagagccaggagttacagacgaagctggag
gactgcaggaacatgatcgcggagctgcgcatagaactgaagaaggccaacagcaaggtg
tgccacaccgagctgctgctcagccaagtgtctcagaagctctcaaatagtgagtcggtc
cagcagcagatggagttcttgaacaggcagctgttggttcttggggaagtcaacgagctg
tatttggaacaactgcagaacaagcattcagacaccacaaaggaagtagaaatgatgaaa
actgcatatcggaaagaactagaaaaaaacagaagccatgttctccagcagaatcagagg
ctggatactgctcaaaaacggattttggaactggaatctcatctagccaagaaagaccac
cttcttttggaacagaaaaaatatttagaggatgtcaaactccaggcaagaggacagctg
caggccgcagagagcaggtatgaagctcagaagaggatcacccaagtgtttgaattggag
atcttagatttatacggcaggttggagaaggatggcctcctgaaaaaacttgaagaagag
aaaacagaagcagccgaagcagcggaagaaaggctcgactgttgtcgtgacggctgcttg
gattctgtgacagggcacaacaatgaagaggcatctggccctaacggggaggccaagccc
cccaggcccggcggtgcccggggcggcggcggaagtagaggaggcggaggcagcagcggc
agcggcagtgagctgtctaccccggagaaacccccaaacccgagggcggccccattgggc
agtcggtgggagactgccgtgggagagcccgctacgggcatccctgtgactgtcggctcc
cttcccagttcaaaaagcttcctgggcatgaaggctcgagagctgttccgtaataagagt
gagagccagtgtgatgaggacagcctgaccagcagtagcctttctgagaccctaaagaca
gagctgggcaaagactcgggtgtggaagccaagcctcccctgaacctagacggcccgcag
ccacctcccccgaagccagacagcgtgggacagctccgtatcatggactacaacgaggtg
cagcacgagcacagctag

DBGET integrated database retrieval system