KEGG   Physeter catodon (sperm whale): 102991493
Entry
102991493         CDS       T06011                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR isoform X1
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04012  ErbB signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04136  Autophagy - other
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04211  Longevity regulating pathway
pcad04213  Longevity regulating pathway - multiple species
pcad04218  Cellular senescence
pcad04371  Apelin signaling pathway
pcad04630  JAK-STAT signaling pathway
pcad04659  Th17 cell differentiation
pcad04714  Thermogenesis
pcad04910  Insulin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04930  Type II diabetes mellitus
pcad04931  Insulin resistance
pcad04935  Growth hormone synthesis, secretion and action
pcad05010  Alzheimer disease
pcad05014  Amyotrophic lateral sclerosis
pcad05016  Huntington disease
pcad05017  Spinocerebellar ataxia
pcad05022  Pathways of neurodegeneration - multiple diseases
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05221  Acute myeloid leukemia
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
pcad05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102991493 (MTOR)
   04371 Apelin signaling pathway
    102991493 (MTOR)
   04630 JAK-STAT signaling pathway
    102991493 (MTOR)
   04066 HIF-1 signaling pathway
    102991493 (MTOR)
   04072 Phospholipase D signaling pathway
    102991493 (MTOR)
   04151 PI3K-Akt signaling pathway
    102991493 (MTOR)
   04152 AMPK signaling pathway
    102991493 (MTOR)
   04150 mTOR signaling pathway
    102991493 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102991493 (MTOR)
   04136 Autophagy - other
    102991493 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    102991493 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    102991493 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    102991493 (MTOR)
   04920 Adipocytokine signaling pathway
    102991493 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    102991493 (MTOR)
   04919 Thyroid hormone signaling pathway
    102991493 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    102991493 (MTOR)
   04213 Longevity regulating pathway - multiple species
    102991493 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    102991493 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102991493 (MTOR)
   05206 MicroRNAs in cancer
    102991493 (MTOR)
   05205 Proteoglycans in cancer
    102991493 (MTOR)
   05230 Central carbon metabolism in cancer
    102991493 (MTOR)
   05231 Choline metabolism in cancer
    102991493 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102991493 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102991493 (MTOR)
   05212 Pancreatic cancer
    102991493 (MTOR)
   05225 Hepatocellular carcinoma
    102991493 (MTOR)
   05226 Gastric cancer
    102991493 (MTOR)
   05214 Glioma
    102991493 (MTOR)
   05221 Acute myeloid leukemia
    102991493 (MTOR)
   05215 Prostate cancer
    102991493 (MTOR)
   05224 Breast cancer
    102991493 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102991493 (MTOR)
   05014 Amyotrophic lateral sclerosis
    102991493 (MTOR)
   05016 Huntington disease
    102991493 (MTOR)
   05017 Spinocerebellar ataxia
    102991493 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    102991493 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    102991493 (MTOR)
   04931 Insulin resistance
    102991493 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102991493 (MTOR)
   05168 Herpes simplex virus 1 infection
    102991493 (MTOR)
   05163 Human cytomegalovirus infection
    102991493 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102991493 (MTOR)
   05165 Human papillomavirus infection
    102991493 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102991493 (MTOR)
   01522 Endocrine resistance
    102991493 (MTOR)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     102991493 (MTOR)
Protein kinases [BR:pcad01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   102991493 (MTOR)
Membrane trafficking [BR:pcad04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    102991493 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 V-ATPase_H_N UME EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 102991493
NCBI-ProteinID: XP_023981357
UniProt: A0A2Y9SVG2
LinkDB
Position
3
AA seq 2548 aa
MLGTGPAAAATATTASSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSVEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAMQPQQSNALVGLLGYSSHQGLVGFGASPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSVHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLTREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEVPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRPTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALAGGPADAGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTVQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNVATAATTAATATATSTEGSNSESEAESTENSPT
PSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVNE
ALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVASK
STTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFGE
RNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQAW
DLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSLQ
VITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNLS
IQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTLM
QKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRHP
SNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITCH
TVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDGV
ELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDETLDV
PTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7647 nt   +upstreamnt  +downstreamnt
atgcttggaaccggccctgccgctgctgccacagctaccaccgcatccagcaatgtgagc
gtcctgcagcagtttgccagcggcctgaagagccggaatgaggagaccagggccaaagcc
gccaaggagctccagcactatgtcaccatggagctccgagagatgagtcaagaagagtct
actcgcttctatgatcagctgaaccatcacatttttgaactggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagccagcctcataggagtggaaggtgggaat
gccacccgaatcggaagatttgctaactaccttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccatcggtcgcctcgccatggccggggacactttt
accgctgagtatgtggagtttgaggtgaagcgagccttggaatggctgggtgctgaccgc
aacgagggccggagacatgcggctgtcctggttcttcgtgagctggccatcagcgtcccc
accttcttcttccagcaagtgcagcccttctttgacaatatttttgtggccgtgtgggac
cccaaacaggccatccgtgagggagctgttgctgcccttcgtgcctgtctgatcctcacc
acccagcgggagccgaaggagatgcagaagccacagtggtacaggcacacgtttgaggaa
gcagagaaagggtttgacgagaccttggccaaggagaagggcatgaatcgcgatgatcgg
atccacggagccttgctgatcctcaacgagctggttcgcatcagcagcgtggagggcgag
cgcctgagagaagaaatggaagaaatcacacagcagcagttggtacatgacaagtactgc
aaggatctcatgggcttcggaacgaaacctcgtcacatcacccccttcaccagtttccag
gccatgcagccccagcagtcaaatgccttggtgggactgctggggtacagctctcaccaa
ggcctcgtgggcttcggggcttcccccagcccagcgaagtccaccctggtggagagtcgc
tgctgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaagtgc
aggaatagcaagaactcgctgatccaaatgacaatcctgaatttgttgccccgcttggct
gccttccgaccttctgccttcacagatacccagtacctccaagataccatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacggacagcagccttccaagccctggggctactt
tctgtggctgtgaggtctgagtttaaggtctatttacctcgtgtgctggacatcatccga
gcagccctgcctcctaaggactttgcccataagagacagaaggcaatgcaggtggatgcc
acggtgttcacctgtatcagcatgctggcccgagcgatggggccgggcatccagcaggac
atcaaggagctgctggagcccatgctggcggtgggactgagccccgccctcacagctgtg
ctctacgacctgagccgtcagattccacagctgaaaaaggacatccaagatggactcctg
aagatgctgtccctggtccttatgcacaaacccctccggcacccaggcatgcccaagggc
ctggcccatcagctggcttcccctggcctcacgaccctccctgaggccagcgatgtgggc
agcattacccttgccctccgaactcttggcagttttgagtttgaaggccactctctgacc
cagtttgtccgccactgtgcggatcacttcctgaacagcgagcacaaggagatccgcatg
gaagccgcccgcacctgctcccgcctgctcacgccctctgtccacctcatcagtggccac
gctcacgtggttagccagaccgcagtgcaagtggtggcggatgtgctcagcaaactgctc
gtggttgggataacagatcctgaccccgacatccgctactgtgtcttggcatccctggac
gagcgctttgacgcacacctggcccaggcagaaaatctgcaggccctgtttgtggccctg
aatgaccaggtgtttgagatccgggagctggccatctgcaccgtgggccggctcagcagc
atgaacccagccttcgtcatgcccttcctgcgcaagatgctcatccagattttgacagag
ctggagcacagtggcattggaagaatcaaggaacagagtgcccgcatgctggggcacctg
gtctccaatgccccccgactcatccgcccctacatggagcctattctgaaggctttaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcttggct
acaataggagagttggctcaggttagtggcctagaaatgaggaagtgggttgatgaactt
tttattatcatcatggacatgctccaggactcctctctgttggccaaaaggcaggtggct
ctgtggaccctgggacagttggtggccagcactggctacgtggtggagccctacaggaag
taccccacattgcttgaggtgctgctgaatttcctgaagactgagcagaaccagggtacg
cggcgagaggctatccgtgtgttaggactcttgggggccttggatccctacaagcacaaa
gtgaacattggcatgatcgaccagtcccgggatgcttctgccgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactacagcaccagtgagatgctggtcaacatgggaaac
ctgcctctggacgagttctacccggccgtgtccatggtggccctgatgcgcatcttccga
gaccagtccctctcgcaccatcacaccatggtcgtccaggccatcaccttcatcttcaag
tccctggggctcaagtgtgtgcagttcctgccccaggtcatgcccacattcctgaatgtc
attcgagtttgtgacggggccatccgggagtttctgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcaggccttacatggatgaaatagtcacacttacgagagag
ttctgggtcatgaacacctccatccagagcacgatcattcttctcattgagcagattgtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgctccga
gttttcatgcatgacaatagcccaggccgcatcgtctccatcaagttgcttgctgcaatc
cagctgtttggtgccaacctggatgactatctgcatctgttgttgccccctatcgtgaag
ttgtttgatgccccggaagtcccattgccatctcgaaaggcagcgttagagacagtggac
cgtctgacggagtccctggatttcactgactatgcctctcggatcattcacccgattgtg
cgaacgctggaccaaagcccagaactccgtcccacagccatggacacgttgtcctcgctc
gtgtttcagctggggaagaagtaccaaattttcattccaatggtaaataaagttctggtg
cgacaccgaatcaaccatcagcgctatgatgtcctcatctgcaggattgtcaagggatac
acccttgctgatgaagaggaggaccctttgatttaccagcatcgaatgctgcggagtggc
caaggggatgcgttggccggcggaccagcggacgcgggacccatgaagaaactgcatgtc
agcaccatcaacctccaaaaggcctggggagctgccagaagggtctccaaagatgactgg
ttggaatggctgaggcggctgagcctggagctgctgaaggactcctcctcaccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatctctttaacgct
gcgtttgtgtcctgctggtctgagctgaatgaagaccagcaggatgagctcatcagaagc
atcgagttggccctcacctcccaggacatcgctgaagtcacacaaaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccattgagagatgacaatggcatt
gttctgctgggtgagagggctgccaagtgccgagcatatgccaaagcgctacactacaaa
gaactggagttccagaaaggtcccacccctgccatcctagagtctctcatcagcattaat
aataagctgcagcagccagaggcagctgccggggtattagaatatgccatgaaacacttc
ggagagctggagatccaggctacctggtatgagaaactgcatgagtgggaggatgctctt
gtggcctatgataagaaaatggacaccaacaaggatgacccggagctgatgctgggccgc
atgcgctgcctcgaggccttgggggagtgggggcagctccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagccgca
tggggtttaggtcagtgggacagcatggaggagtacacctgcatgatccctcgggatacc
cacgacggggcattttacagagccgtgctggcgctgcatcaggacctcttctccttggcg
cagcagtgcatcgacaaagcccgggacctgctggacgccgagttaactgccatggcagga
gagagctacagccgggcgtatggggccatggtttcttgccacatgctctccgagctggag
gaggtcatccagtacaaacttgtccccgagcgccgggagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtattgtggaggactggcagaaaatcctcatggtgcgg
tcgctcgtggtcagccctcacgaggacatgaggacctggctcaagtatgcaagcctgtgt
ggcaagagtggccggctggctcttgctcacaaaaccttagtgctgctcctgggagttgat
ccatctcggcaacttgaccaccctctgccgacagttcacccccaggtgacctacgcgtac
atgaaaaatatgtggaagagcgctcgcaagatcgatgccttccagcacatgcagcacttt
gttcagaccgtgcagcagcaagcccagcacgccatcgccaccgaggaccagcagcacaag
caggagctgcacaagcttatggcccgatgtttcctgaaactcggggagtggcagctgaac
ctgcagggcatcaacgagagcacgatccccaaagtcctgcagtattacagcgccgccacg
gagcacgaccgcagctggtacaaggcctggcacgcgtgggctgtgatgaacttcgaggct
gtgctccactacaaacatcagaaccaagcccgcgatgagaagaagaaactgcgtcacgcc
agcggggccaacatcaccaacgtggccactgccgccaccacggcggccacggccactgcc
accagcactgagggtagtaacagcgagagcgaggctgagagcactgagaacagccctacc
ccatctcctctgcagaagaaggtcactgaggatttgtccaaaaccctcttgatgtacacc
gtccctgctgtccagggcttcttccgatccatctctttgtcacgaggcaacaacctccag
gacacgctcagagtcctcaccttatggtttgattatggtcactggccagatgtaaatgaa
gccttagtggaaggggtgaaagcgatccagattgacacttggttacaggttatacctcag
ctcattgcgagaattgatacaccgaggcccttggtgggacgtctcattcaccagcttctc
acagacattggtcggtaccacccccaggccctcatctacccgctgacggtggcttctaag
tctaccaccacagcccgtcacaatgcggccaacaagattctgaagaacatgtgcgagcac
agtaacaccttggtgcaacaggccatgatggtgagtgaggagctgatccgagtggccatt
ctctggcatgagatgtggcacgaaggcctggaagaggcatctcgcttgtactttggggag
aggaacgtgaaaggcatgttcgaggtgctggagcccctgcatgctatgatggagcgggga
ccccagactctgaaggaaacatcctttaaccaggcgtatggtcgagatttaatggaggcc
caagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacccaagcctgg
gacctctattaccacgtgttcagacgaatctcaaagcagctgcctcagctcacatcctta
gagctgcagtacgtgtccccaaaacttctgatgtgccgggacctggaattggctgtgccg
ggaacatacgaccccaaccagccgatcattcgcattcagtccattgcaccatctctacaa
gtcatcacgtccaagcagaggccccggaagttgacgcttatgggcagcaacgggcacgag
tttgtcttcctcctgaagggccatgaagatctgcggcaggacgagcgagtgatgcagctc
ttcggcctggtcaacacccttctggccaatgacccaacgtctcttcggaaaaatctcagc
atccagagatacgctgtcattcccttgtcaaccaattcgggcctcatcggctgggtcccc
cactgtgacacgctgcatgccctcatccgggactacagggagaaaaagaagatccttctc
aacatcgagcatcgcatcatgctgcggatggctccggactacgaccacctgactctgatg
cagaaggttgaggtgtttgagcacgccgtcaacaacacggcgggcgacgacctggccaag
ctgctgtggctgaagagccccagctccgaggtgtggtttgatcgaagaaccaattacacc
cgctctttagcggtcatgtccatggttgggtatattttgggcctgggcgatagacaccca
tccaacctgatgctggaccggctgagcgggaagatcctgcacattgactttggggactgc
tttgaggttgctatgaccagagagaaattcccagagaagattccgtttagactaacaaga
atgttgaccaatgctatggaggtcacgggcctggatggcaactacagaatcacgtgccac
acagtgatggaagtgcttcgggagcacaaggacagcgtcatggccgtgctggaagccttc
gtctacgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaagcga
tcacgaacgaggacagattcctactctgctggccagtcagtagaaattttggatggtgtg
gaacttggggaaccagcccataagaaaacggggactacagtgccagaatctattcattct
ttcattggagacggtttggtaaaaccagaggccctaaataagaaagctattcaaattatt
aaccgagttcgagataagctcactggtcgggacttctctcacgatgaaacgttggatgtc
ccaacacaagttgagctgctcatcaaacaagcaacatcccatgaaaacctctgccagtgc
tacatcggctggtgtcctttctggtaa

DBGET integrated database retrieval system