KEGG   Physeter catodon (sperm whale): 102992196
Entry
102992196         CDS       T06011                                 

Gene name
HGF
Definition
(RefSeq) hepatocyte growth factor isoform X1
  KO
K05460  hepatocyte growth factor
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad05144  Malaria
pcad05200  Pathways in cancer
pcad05205  Proteoglycans in cancer
pcad05211  Renal cell carcinoma
pcad05218  Melanoma
pcad05223  Non-small cell lung cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102992196 (HGF)
   04014 Ras signaling pathway
    102992196 (HGF)
   04015 Rap1 signaling pathway
    102992196 (HGF)
   04020 Calcium signaling pathway
    102992196 (HGF)
   04151 PI3K-Akt signaling pathway
    102992196 (HGF)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102992196 (HGF)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102992196 (HGF)
   05205 Proteoglycans in cancer
    102992196 (HGF)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102992196 (HGF)
   05226 Gastric cancer
    102992196 (HGF)
   05218 Melanoma
    102992196 (HGF)
   05211 Renal cell carcinoma
    102992196 (HGF)
   05223 Non-small cell lung cancer
    102992196 (HGF)
  09174 Infectious disease: parasitic
   05144 Malaria
    102992196 (HGF)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102992196 (HGF)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pcad04052]
    102992196 (HGF)
   00536 Glycosaminoglycan binding proteins [BR:pcad00536]
    102992196 (HGF)
Cytokines and growth factors [BR:pcad04052]
 Growth factors
  Growth factors (RTK binding)
   102992196 (HGF)
Glycosaminoglycan binding proteins [BR:pcad00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   102992196 (HGF)
SSDB
Motif
Pfam: Kringle Trypsin PAN_1 DUF1986 DUF316 CWC25
Other DBs
NCBI-GeneID: 102992196
NCBI-ProteinID: XP_023971728
UniProt: A0A2Y9RZG7
LinkDB
Position
5
AA seq 730 aa
MWVTKLLPALLLQHVLLHLLRLPIATPYAEGQKKRRNTLHEFKKSAKTTLIKEDPLLKIK
TKKMNTADQCANRCIRNKGLPFTCKAFVFDKARKRCLWFPFNSMSSGVRKEFGHEFDLYE
NKDYIRNCIIGKGGSYKGTVSITKSGIKCQPWNSMIPHEHSFLPSSYRGKDLQENYCRNP
RGEEGGPWCFTSNPEVRYEVCDIPQCSEVECMTCNGESYRGPMDHTESGKICQRWDHQTP
HRHKFLPERYPDKGFDDNYCRNPDGKPRPWCYTLDPDTPWEYCAIKMCAHSTMNDTDVPM
ETTECIQGQGEGYRGIINTIWNGIPCQRWDSQYPHQHDITPENFKCKDLRENYCRNPDGA
ESPWCFTTDPNIRVGYCSQIPKCDVSSGQDCYRGNGKNYMGNLSKTRSGLTCSMWDKNME
DLHRHIFWEPDASKLNKNYCRNPDDDAHGPWCYTGNPLIPWDYCPISRCEGDTTPTIVNL
DHPVISCAKTKQLRVVNGIPTRTNVGWMVSLKYRNKHICGGSLIKESWILTARQCFPSRN
KDLKDYEAWLGIHDVHGRGDEKRKQVLNVTQLVYGPEGSDLVLLKLARPAVLDDFVSTID
LPNYGCTIPEKTTCSVYGWGYTGLINSDGLLRVAHLYIMGNEKCSQYHQGKVTLNESEIC
AGAENIVSGPCEGDYGGPLVCEQHKMRMVLGVIVPGRGCAIPNRPGIFVRVAYYAKWIHK
IILTYKVPQS
NT seq 2193 nt   +upstreamnt  +downstreamnt
atgtgggtgaccaaactcctgccagccttactgctgcagcacgtcctcctccacctcctc
cggcttcccattgccaccccctatgcagaaggacagaagaaaagaagaaacacacttcat
gaattcaaaaagtcagcaaagactactctaattaaagaagacccattactgaagataaaa
acaaaaaaaatgaacactgcagaccaatgtgccaatagatgtattaggaataaaggactt
ccattcacttgcaaggcctttgtttttgacaaagcaagaaagcgatgcctctggttccct
ttcaatagcatgtcaagtggagtgagaaaagagtttggccatgaatttgacctctatgaa
aacaaagactacattagaaactgcatcatcggtaaaggaggtagctataaggggacagta
tctatcactaaaagtggcatcaaatgccagccctggaattccatgataccacacgaacac
agctttttgccttcgagctatcggggtaaagacctacaggaaaactactgccgaaatcct
cgaggggaagaagggggaccttggtgtttcacaagcaatccagaggtacgctacgaagtc
tgtgacattcctcagtgttcagaagttgaatgcatgacctgcaatggggaaagttatcga
ggtcccatggatcatacagaatcaggcaagatttgtcagcgctgggatcatcagacgcca
catcggcataaattcttgccagaaagatatcccgacaagggctttgatgataattattgc
cgcaatcctgatggcaagccgaggccatggtgctatactcttgaccctgacaccccctgg
gagtactgtgcaattaaaatgtgcgctcacagtactatgaatgacacggatgtccctatg
gaaacaactgaatgcattcaaggtcaaggagaaggttaccggggcatcatcaataccatt
tggaatggaattccctgtcagcgttgggattcccagtatcctcaccagcatgacataact
cctgaaaatttcaagtgcaaggacctaagagaaaattattgccgaaatccagatggggct
gagtcaccgtggtgttttaccactgatccaaacatccgagttggctactgctcccaaatt
ccaaaatgtgatgtgtcaagtggacaagattgttatcgtgggaatggcaaaaactatatg
ggcaatttatccaaaacacgatctggactaacatgttcgatgtgggacaagaacatggaa
gatttacatcggcatatcttctgggaaccagacgctagtaagctgaataagaattactgc
cggaatcctgatgatgatgcccatggtccctggtgttacacggggaatcctctcattcct
tgggattactgccctatttctcgttgtgaaggtgataccacacctacaatagtcaattta
gaccatcctgtaatatcttgcgccaaaacaaaacaattgcgagttgtaaatggaattcca
acacgaacaaatgtaggatggatggttagtttgaaatacagaaataaacatatctgtgga
ggatcactgataaaggaaagttggattcttactgcaagacagtgtttcccttctcgaaac
aaagacttgaaagattatgaagcttggcttggaattcatgatgtccatggaagaggagat
gagaaacgcaaacaggttctaaatgttacgcaactggtatatgggccggaaggatcagat
ctggtattactgaagcttgctaggcctgctgttctggatgattttgttagtacaattgat
ttacctaattatgggtgcacaattcctgaaaaaaccacttgcagtgtttatggctggggc
tacactggattgatcaactcagacggtctattacgagtagcacatctctatattatgggg
aatgagaaatgcagccaatatcatcaagggaaggtgactctgaatgagtctgaaatatgt
gctggggctgaaaatattgtatcaggaccatgcgagggagattatggtggcccactggtt
tgtgaacaacataaaatgagaatggttcttggtgtcatcgttcctggtcgtggatgtgcc
attccaaatcgtcctggtatttttgtccgagtggcatattatgcaaaatggatacacaaa
attatattaacgtataaggtaccacagtcgtag

DBGET integrated database retrieval system