KEGG   Physeter catodon (sperm whale): 102992808
Entry
102992808         CDS       T06011                                 

Gene name
RALGDS
Definition
(RefSeq) ral guanine nucleotide dissociation stimulator isoform X5
  KO
K08732  ral guanine nucleotide dissociation stimulator
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad05200  Pathways in cancer
pcad05210  Colorectal cancer
pcad05212  Pancreatic cancer
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102992808 (RALGDS)
   04015 Rap1 signaling pathway
    102992808 (RALGDS)
   04072 Phospholipase D signaling pathway
    102992808 (RALGDS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102992808 (RALGDS)
   05231 Choline metabolism in cancer
    102992808 (RALGDS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102992808 (RALGDS)
   05212 Pancreatic cancer
    102992808 (RALGDS)
SSDB
Motif
Pfam: RasGEF RasGEF_N RA
Other DBs
NCBI-GeneID: 102992808
NCBI-ProteinID: XP_023973087
UniProt: A0A2Y9S6Z1
LinkDB
Position
Unknown
AA seq 847 aa
MVQRMWAEAAGPAGGAEPLFPGSRRSRSVWDAVRLEVGGPDSCPVVLHSFTQLDPDLPRL
ESSTQEIGEELVNGVIYSISLRKVQVHHGASKGQRWLGYENESALNLYETCKVRTVKAGT
LEKLVEHLVPAFQGSDLSYVTIFLCTYRAFTTTQRVLDLLFQRYGRCDALTASSRYGCIL
PYSSEDGGPQDQLKNAVSSILGTWLDQYSEDFCQPPDFPCLKQLVAYVQLNMPGSDLERR
AHLLLAQLERAELAKAEPEALAPALKPAPARAPRPEPGPDLEPAPAPAPAPEPSWPLPVA
AENGLGEEKPHLLAFPADLVAEQFTFMDAELFKKVVPYHCLGSIWSQRDKRGKEHLAPTV
RATVAQFNSVANCVITTCLGDRSVTARSRARVVEHWIEVARECRVLKNFSSLYAILSALQ
SNSIHRLKKTWEEVSRDSLRIFQKLSEIFSDENNYSLSRELLIKEGTSKFATLEMNPKRA
QRRPKEVLSQGVIQGTVPYLGTFLTDLVMLDTAMKDYLYGRLINFEKRRKEFEVIAQIKL
LQSACNNYSIAPEEHFGAWFRAMERLSEADSYTLSCELEPPSESASNTLKVKKNTAIVKR
WSDRQAPSTELSPGSSCHSKSCDQLRCGPYLSGGDIADALSVRSAGSSSSDVEEINMSFV
PESPDGQEKKCWESASQSSPETSGISSASSSTSSSSASTTPVAATRTHKRSVSGVCSYSS
SLPLYNQQVGDCCIIRVSLDVDNGNMYKSILVTSQDKAPAVIRKAMDKHNLDEDEPEDYE
LVQVLSDDRKLKIPDNANVFYAMNSTANYDFVLKKRTFTKGAKVRHGASSTLPRMKQKGL
KIAKGIF
NT seq 2544 nt   +upstreamnt  +downstreamnt
atggtgcagcgcatgtgggccgaggcggccggccctgcgggcggcgccgagccgctgttt
ccgggctcccggcggagccgcagcgtgtgggacgccgtgcgcctggaggtgggcggcccc
gacagctgcccggtggtgctgcacagtttcacgcagctcgaccccgaccttccgcgcctg
gagagctccacgcaggagattggcgaggagctggtcaacggcgtcatctactccatctcc
ctgcgcaaggttcaggtgcaccacggcgccagcaagggccagcgctggctcgggtatgaa
aatgagtcggccctgaacctgtatgagacctgcaaggtgcggaccgtgaaggcaggcacg
ctggagaagctggtggagcacctggtgcccgccttccagggcagcgacctctcctatgtc
accatcttcctgtgcacctaccgagccttcaccaccacccagcgggtcctggacctgctg
ttccaaaggtacggtagatgtgacgccctcacggcctcctctagatatgggtgcatcctc
ccttattccagcgaggacggcggacctcaggaccaactgaaaaatgccgtctcctccatc
ctgggcacctggctggaccagtactccgaggacttctgtcagcccccggacttcccctgc
ctcaagcagctggtggcctatgtgcagctcaacatgcccggctccgacctggagcgccgg
gcccaccttctcctggcccagctggagcgcgcagagctcgccaaggcagagccggaggct
ctggctccagctctgaagccggctccagctcgagcacccaggccggagccgggtccagac
ctcgagccagcgccggctccagcaccagccccagagccttcctggcctttgcctgtggcc
gcagagaacgggctgggtgaggagaagccccacctcctggcgttcccggccgacctggtg
gcggagcagttcacgttcatggacgcggagctgttcaagaaggtggtgccctaccactgc
ctgggctccatctggtcccagcgggacaagaggggcaaagagcacctggctcccaccgtc
cgtgccaccgtcgcccagttcaacagtgtggccaactgcgtcatcaccacctgcctcggg
gaccggagcgtgacggcccgctccagggccagggtggtggagcactggatcgaggtggcc
agggagtgccgggtcctcaagaacttttcttccctctacgccatcctctctgctctgcag
agcaactccatccaccggctgaagaagacgtgggaagaagtttccagggacagcctccgc
atctttcagaagctgtcggagattttctcagacgagaacaactactccctaagcagagag
ctgctcatcaaggaggggacctccaagtttgccaccctggagatgaaccccaagagagcc
cagaggcggccgaaggaggtgttgtcacagggtgtcatccagggcaccgttccctacctg
ggcacgttcctcacagacctggtgatgctggacactgccatgaaggactatctgtatggg
agactgatcaacttcgagaagaggaggaaggagttcgaagtgatcgcccagatcaagctg
ctccagtcggcctgcaacaattacagcatcgcacccgaagagcactttggggcctggttc
cgggctatggagcggctcagcgaggctgacagctacaccttgtcgtgtgagctggagccc
ccttccgagtcggccagcaacaccctcaaggtcaagaagaacacggccatcgtcaagcgc
tggagcgaccgccaggcccccagcacggagctcagtcccggcagcagctgccactccaag
tcctgtgaccagctcaggtgcggcccctacctcagcggcggggacattgccgacgcactc
agtgtccgctcggccggctcctccagctccgacgtggaggagatcaacatgagctttgtc
ccagagtcccctgacggccaggagaagaagtgctgggagtctgcctcccagtcgtccccg
gagacctccggcatcagctcggcctccagcagcacctcgtcctcctcagcctccaccacg
cccgtggccgccacgcgcacccacaagcgctccgtgtcaggggtctgcagctacagctcc
tcgctgcccctctacaaccagcaggtgggcgactgctgcatcatccgggtgagcctggac
gtggacaacggcaacatgtacaagagcatcctggtgaccagccaagacaaggctccagct
gtaatccgcaaagccatggacaaacacaacctggatgaggatgagccagaagactacgag
ctggtgcaggttctttcggatgatcgaaagctgaagatccctgacaacgccaatgtgttc
tacgccatgaactctactgccaactatgactttgtcctaaagaaacggaccttcaccaag
ggggcaaaggtcaggcatggagccagctctaccctcccccgcatgaagcagaagggactc
aagattgccaagggcatcttctaa

DBGET integrated database retrieval system