KEGG   Physeter catodon (sperm whale): 102994349
Entry
102994349         CDS       T06011                                 

Gene name
PDGFRA
Definition
(RefSeq) platelet-derived growth factor receptor alpha
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad04010  MAPK signaling pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04020  Calcium signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04144  Endocytosis
pcad04151  PI3K-Akt signaling pathway
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04630  JAK-STAT signaling pathway
pcad04810  Regulation of actin cytoskeleton
pcad05163  Human cytomegalovirus infection
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05230  Central carbon metabolism in cancer
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102994349 (PDGFRA)
   04014 Ras signaling pathway
    102994349 (PDGFRA)
   04015 Rap1 signaling pathway
    102994349 (PDGFRA)
   04630 JAK-STAT signaling pathway
    102994349 (PDGFRA)
   04020 Calcium signaling pathway
    102994349 (PDGFRA)
   04072 Phospholipase D signaling pathway
    102994349 (PDGFRA)
   04151 PI3K-Akt signaling pathway
    102994349 (PDGFRA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102994349 (PDGFRA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    102994349 (PDGFRA)
   04540 Gap junction
    102994349 (PDGFRA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    102994349 (PDGFRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102994349 (PDGFRA)
   05206 MicroRNAs in cancer
    102994349 (PDGFRA)
   05230 Central carbon metabolism in cancer
    102994349 (PDGFRA)
   05231 Choline metabolism in cancer
    102994349 (PDGFRA)
  09162 Cancer: specific types
   05214 Glioma
    102994349 (PDGFRA)
   05218 Melanoma
    102994349 (PDGFRA)
   05215 Prostate cancer
    102994349 (PDGFRA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    102994349 (PDGFRA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    102994349 (PDGFRA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcad01001]
    102994349 (PDGFRA)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pcad04090]
    102994349 (PDGFRA)
Enzymes [BR:pcad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102994349 (PDGFRA)
Protein kinases [BR:pcad01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   102994349 (PDGFRA)
CD molecules [BR:pcad04090]
 Proteins
  102994349 (PDGFRA)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase Ig_3 I-set ig Ig_2 Herpes_gE V-set Kinase-like
Other DBs
NCBI-GeneID: 102994349
NCBI-ProteinID: XP_007111306
UniProt: A0A2Y9F044
LinkDB
Position
7
AA seq 1089 aa
MGTSHWALLVLGCLLTGPSLILCQLSLPSILPNENERVVQLNSSFSLRCFGENEVSWQYP
MSEEENPNVEIRNEENNSGLFVTVLEVVSASAAHTGLYTCYYNHTQLEESEIEGRRIYIY
VPDPDVAFVPLGMTDYLVIVEDDDSAIIPCRTTDPETPVILLSSDGVVHASYDSRQGFNG
TFTVGPYICEATVRGKKFQTIPFNVYALKATSELDLEMEALKTVYKAGESIVVTCAVFNN
EVVDLQWTYPGQVKGKGITMLEETKVPSIKLVYTLMVPEATVKDSGDYECAARQATKEVK
EMKKVTISVHEKGFIEIKPNFSPLEAVNLHEVKHFVVDVQAYPPPRIAWLKDNLTLIENL
TEITTDIEKIQEIRYRSKLKLIRAKEEDSGHYTIVVQNEDDVKSYTFELLTQVPSSILDL
VDDHHGSNGGQTVRCTAEGTPLPDIEWMICKDIKKCNNETSWTILASNVSNIITEVHPRD
RSMVEGQVTFAKVEETIAVRCLAKNLLGVESRELKLVAPTLRSELTVAAAVLVLLVIVII
SLIVLVVIWKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRILG
SGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNL
LGACTKSGPIYIITEYCFYGDLVNYLHKNRDSFLSRHPEKPKKELDIFGLNPADESTRSY
VILSFENNGDYMDMKQADTTQYVPMLERKEVSKYSDIQRALYDRPASYKKKSMLDSEVKN
LLSDDNSEGLTLLDLLSFTYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLA
RDIMHDSNYVSKGSTFLPVKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMM
VDSTFYNKIKSGYRMAKPDHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKK
SYEKIHLDFLKSDHPAVARMRVDSNNAYIGVTYKNEEDKLKDWEGGLDEQRLSADSGYII
PLPDIDPVPEEEDLGKRNRHSSQTSEESAIETGSSSSTFIKREDETIEDIDMMDDIGIDS
SDLVEDSFL
NT seq 3270 nt   +upstreamnt  +downstreamnt
atggggacttcccattgggcgctcctggtcttaggctgtctcctcacagggccgagcctc
atcctctgccagctttcattaccctccatcctgcccaatgaaaacgagagggttgtgcag
ctgaattcatccttttctctgagatgctttggggagaatgaagtgagctggcagtacccc
atgtctgaagaagagaaccccaatgtggaaatcagaaatgaggagaacaacagtggcctt
tttgtgacggtgctggaagtggtcagtgcctcggcggcccacacagggctgtacacttgc
tattacaaccacacgcagttggaagaaagcgagatcgagggcagacgcatttacatctat
gtgccagacccagatgtagccttcgtacctctaggaatgacagattacttggtcatcgtg
gaggacgatgattctgccatcatcccttgtcgaacgactgatcctgagacaccagtgatc
ttactcagcagtgacggggtggtgcacgcctcctatgacagcagacaaggctttaatgga
accttcactgtcggaccctatatctgcgaggccaccgtcagggggaagaagttccagacc
attccattcaatgtttatgctttaaaagcaacatcagaacttgatctggaaatggaagct
cttaaaactgtatataaggcaggggaatcgattgtggtcacctgcgccgtctttaacaat
gaggttgtggaccttcagtggacttaccctggacaagtgaaaggcaaaggcatcacaatg
ctggaggaaaccaaggtcccgtccatcaaactggtgtacactctgatggtccctgaggcc
acggtgaaagatagtggagattacgaatgtgctgcccgccaggccaccaaggaggtcaaa
gaaatgaagaaagtcaccatctctgtgcatgagaaagggtttatcgaaatcaaacccaac
ttcagcccgttggaagctgtcaacctgcatgaagtcaaacattttgtggtggacgtgcag
gcctacccccctcccaggatagcctggctgaaggacaacctgactctgattgagaatctc
acggagatcaccactgacatagaaaagattcaggaaataaggtatcgaagcaaattaaag
ctgatccgagctaaggaagaagacagcggccattatactattgtagttcaaaatgaagac
gatgtgaagagctatacttttgaactcttaactcaagttccgtcatccattctggacttg
gtcgacgaccaccatggctctaatgggggccagacagtgagatgcacagctgaaggaacc
cctcttcctgatattgagtggatgatttgcaaggatattaagaaatgtaataacgaaact
tcatggacgattttggccagcaatgtctcaaacatcatcacggaggtccacccccgagac
aggagcatggtggagggccaagtgacattcgccaaagtggaggagaccattgcagtacga
tgcctggctaagaatctcctcggggtggagagccgagagctgaagttggtggctcccact
ctgcgttctgaactcacggtggcggccgcagtcctggtgttgttggtgattgtgatcatc
tcactcattgtcctggttgtcatttggaaacagaaaccaaggtatgagattcgctggagg
gtcattgaatcaatcagccccgatggacatgaatatatttatgtggacccgatgcaactg
ccttatgactcgagatgggagtttccaagagatggactagtgcttggtcgtatcctgggc
tctggtgcatttgggaaagtggttgaaggaactgcctatggattaagtcggtcccaacct
gtcatgaaagtagcagtgaagatgctgaaacccacagccagatccagtgaaaaacaagct
ctcatgtctgaactgaagataatgacccacctggggccgcatttaaacattgtgaacttg
ctgggagcctgcaccaagtcaggccccatttacatcatcactgagtactgcttctatggg
gatttggtcaactacttgcataagaatagggacagcttcttgagccgccacccagagaag
ccaaagaaagagctggacatttttggattgaaccctgctgacgaaagcacacgaagttac
gttattttatcttttgaaaacaacggtgactacatggacatgaagcaagctgacactaca
cagtatgtccccatgctggaaaggaaagaggtttctaagtactcagacatccagagagcg
ctgtatgatcgcccagcctcatataagaagaaatccatgttagactcagaagtcaaaaac
ctcctttcggatgataactcagaaggccttactttgttggatttgttgagctttacctat
caagttgcccgaggaatggagtttttggcttcaaaaaattgtgtccaccgggacctggcc
gctcgcaacgtcctcctggcacaagggaaaatcgtgaagatctgtgactttggcttggcc
agagacatcatgcatgattcgaactacgtgtcaaaaggcagcaccttcctccctgtgaag
tggatggctcctgagagcatcttcgacaacctctacaccacactgagcgacgtctggtct
tacggcattctgctctgggagatcttttccctcggtggcacaccctaccctggcatgatg
gtggattctactttctacaataagatcaagagtgggtaccggatggccaagcctgaccac
gccaccagtgaagtctacgagatcatggtgaagtgctggaacagtgagccagagaagaga
ccctccttttaccacctgagtgagattgtggagaatctgctgcccggacaatataaaaag
agttatgaaaagatccacctggacttcctgaagagtgaccatcccgccgtggcacgtatg
cgcgtggactccaacaacgcctacattggcgtcacctacaaaaacgaggaggacaagctg
aaggactgggagggtggcctcgatgagcagaggctgagcgcggacagtggctacatcatc
cctctgcctgacatcgaccctgttcctgaggaggaagacctgggcaaaaggaacagacac
agctcacagacctctgaagagagtgccattgagacaggttccagcagttctaccttcatc
aagagagaggatgagaccatcgaggacatcgacatgatggacgacattggcatagactcc
tcggacctggtggaagacagcttcctgtaa

DBGET integrated database retrieval system