KEGG   Physeter catodon (sperm whale): 102994517
Entry
102994517         CDS       T06011                                 

Gene name
RHEB
Definition
(RefSeq) GTP-binding protein Rheb
  KO
K07208  Ras homolog enriched in brain
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04072  Phospholipase D signaling pathway
pcad04140  Autophagy - animal
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04152  AMPK signaling pathway
pcad04211  Longevity regulating pathway
pcad04218  Cellular senescence
pcad04714  Thermogenesis
pcad04910  Insulin signaling pathway
pcad04919  Thyroid hormone signaling pathway
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    102994517 (RHEB)
   04151 PI3K-Akt signaling pathway
    102994517 (RHEB)
   04152 AMPK signaling pathway
    102994517 (RHEB)
   04150 mTOR signaling pathway
    102994517 (RHEB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    102994517 (RHEB)
  09143 Cell growth and death
   04218 Cellular senescence
    102994517 (RHEB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102994517 (RHEB)
   04919 Thyroid hormone signaling pathway
    102994517 (RHEB)
  09149 Aging
   04211 Longevity regulating pathway
    102994517 (RHEB)
  09159 Environmental adaptation
   04714 Thermogenesis
    102994517 (RHEB)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    102994517 (RHEB)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    102994517 (RHEB)
   05163 Human cytomegalovirus infection
    102994517 (RHEB)
   05165 Human papillomavirus infection
    102994517 (RHEB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:pcad04031]
    102994517 (RHEB)
GTP-binding proteins [BR:pcad04031]
 Small (monomeric) G-proteins
  Ras Family
   Rheb
    102994517 (RHEB)
SSDB
Motif
Pfam: Ras Roc Arf MMR_HSR1 GTP_EFTU SRPRB RsgA_GTPase
Other DBs
NCBI-GeneID: 102994517
NCBI-ProteinID: XP_028345374
UniProt: A0A455B9N3
LinkDB
Position
5
AA seq 188 aa
MPQSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD
TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK
KDLHMERVISYEEGKALAESWNAAFLESSAKENQPCRCSFKGIFEEGCHFYFRRLPVSPF
PFSSMALI
NT seq 567 nt   +upstreamnt  +downstreamnt
atgccgcagtccaagtcccggaagatcgcgatcctgggctaccggtctgtggggaaatcc
tcattgacgattcagtttgttgaaggccaatttgttgattcctacgatccaaccatagaa
aacactttcacaaaattgatcacagtaaatggacaagaatatcatcttcaacttgtagat
acagctgggcaggatgaatattccatctttcctcagacatactccatagatattaatggt
tatattcttgtgtattctgttacatcaatcaaaagctttgaagtgatcaaagttatccat
ggcaaactgttggatatggtggggaaagtacagatacctattatgttggttgggaataag
aaggacctgcatatggaaagggtgatcagttatgaagaagggaaagcgttagcagaatct
tggaacgcagcttttttggaatcttctgctaaagaaaatcagccctgcagatgttccttt
aaaggcatattcgaggaaggatgtcacttctatttcagaaggcttcccgtatctcctttt
cccttttcctccatggcgttaatttag

DBGET integrated database retrieval system