Physeter catodon (sperm whale): 102994715 Help Entry 102994715         CDS       T06011                                  Symbol HRAS Name (RefSeq) GTPase HRas isoform X2   KO K02833   GTPase HRas Organism pcad  Physeter catodon (sperm whale) Pathway pcad01521   EGFR tyrosine kinase inhibitor resistance pcad01522   Endocrine resistance pcad04010   MAPK signaling pathway pcad04012   ErbB signaling pathway pcad04014   Ras signaling pathway pcad04015   Rap1 signaling pathway pcad04062   Chemokine signaling pathway pcad04068   FoxO signaling pathway pcad04071   Sphingolipid signaling pathway pcad04072   Phospholipase D signaling pathway pcad04137   Mitophagy - animal pcad04140   Autophagy - animal pcad04144   Endocytosis pcad04150   mTOR signaling pathway pcad04151   PI3K-Akt signaling pathway pcad04210   Apoptosis pcad04211   Longevity regulating pathway pcad04213   Longevity regulating pathway - multiple species pcad04218   Cellular senescence pcad04360   Axon guidance pcad04370   VEGF signaling pathway pcad04371   Apelin signaling pathway pcad04510   Focal adhesion pcad04540   Gap junction pcad04550   Signaling pathways regulating pluripotency of stem cells pcad04625   C-type lectin receptor signaling pathway pcad04630   JAK-STAT signaling pathway pcad04650   Natural killer cell mediated cytotoxicity pcad04660   T cell receptor signaling pathway pcad04662   B cell receptor signaling pathway pcad04664   Fc epsilon RI signaling pathway pcad04714   Thermogenesis pcad04720   Long-term potentiation pcad04722   Neurotrophin signaling pathway pcad04725   Cholinergic synapse pcad04726   Serotonergic synapse pcad04730   Long-term depression pcad04810   Regulation of actin cytoskeleton pcad04910   Insulin signaling pathway pcad04912   GnRH signaling pathway pcad04915   Estrogen signaling pathway pcad04916   Melanogenesis pcad04917   Prolactin signaling pathway pcad04919   Thyroid hormone signaling pathway pcad04921   Oxytocin signaling pathway pcad04926   Relaxin signaling pathway pcad04929   GnRH secretion pcad04933   AGE-RAGE signaling pathway in diabetic complications pcad04935   Growth hormone synthesis, secretion and action pcad05010   Alzheimer disease pcad05022   Pathways of neurodegeneration - multiple diseases pcad05034   Alcoholism pcad05132   Salmonella infection pcad05160   Hepatitis C pcad05161   Hepatitis B pcad05163   Human cytomegalovirus infection pcad05165   Human papillomavirus infection pcad05166   Human T-cell leukemia virus 1 infection pcad05167   Kaposi sarcoma-associated herpesvirus infection pcad05170   Human immunodeficiency virus 1 infection pcad05200   Pathways in cancer pcad05203   Viral carcinogenesis pcad05205   Proteoglycans in cancer pcad05206   MicroRNAs in cancer pcad05207   Chemical carcinogenesis - receptor activation pcad05208   Chemical carcinogenesis - reactive oxygen species pcad05210   Colorectal cancer pcad05211   Renal cell carcinoma pcad05213   Endometrial cancer pcad05214   Glioma pcad05215   Prostate cancer pcad05216   Thyroid cancer pcad05218   Melanoma pcad05219   Bladder cancer pcad05220   Chronic myeloid leukemia pcad05221   Acute myeloid leukemia pcad05223   Non-small cell lung cancer pcad05224   Breast cancer pcad05225   Hepatocellular carcinoma pcad05226   Gastric cancer pcad05230   Central carbon metabolism in cancer pcad05231   Choline metabolism in cancer pcad05235   PD-L1 expression and PD-1 checkpoint pathway in cancer pcad05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:pcad00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     102994715 (HRAS)    04012 ErbB signaling pathway     102994715 (HRAS)    04014 Ras signaling pathway     102994715 (HRAS)    04015 Rap1 signaling pathway     102994715 (HRAS)    04370 VEGF signaling pathway     102994715 (HRAS)    04371 Apelin signaling pathway     102994715 (HRAS)    04630 JAK-STAT signaling pathway     102994715 (HRAS)    04068 FoxO signaling pathway     102994715 (HRAS)    04072 Phospholipase D signaling pathway     102994715 (HRAS)    04071 Sphingolipid signaling pathway     102994715 (HRAS)    04151 PI3K-Akt signaling pathway     102994715 (HRAS)    04150 mTOR signaling pathway     102994715 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     102994715 (HRAS)    04140 Autophagy - animal     102994715 (HRAS)    04137 Mitophagy - animal     102994715 (HRAS)   09143 Cell growth and death    04210 Apoptosis     102994715 (HRAS)    04218 Cellular senescence     102994715 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     102994715 (HRAS)    04540 Gap junction     102994715 (HRAS)    04550 Signaling pathways regulating pluripotency of stem cells     102994715 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     102994715 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     102994715 (HRAS)    04650 Natural killer cell mediated cytotoxicity     102994715 (HRAS)    04660 T cell receptor signaling pathway     102994715 (HRAS)    04662 B cell receptor signaling pathway     102994715 (HRAS)    04664 Fc epsilon RI signaling pathway     102994715 (HRAS)    04062 Chemokine signaling pathway     102994715 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     102994715 (HRAS)    04929 GnRH secretion     102994715 (HRAS)    04912 GnRH signaling pathway     102994715 (HRAS)    04915 Estrogen signaling pathway     102994715 (HRAS)    04917 Prolactin signaling pathway     102994715 (HRAS)    04921 Oxytocin signaling pathway     102994715 (HRAS)    04926 Relaxin signaling pathway     102994715 (HRAS)    04935 Growth hormone synthesis, secretion and action     102994715 (HRAS)    04919 Thyroid hormone signaling pathway     102994715 (HRAS)    04916 Melanogenesis     102994715 (HRAS)   09156 Nervous system    04725 Cholinergic synapse     102994715 (HRAS)    04726 Serotonergic synapse     102994715 (HRAS)    04720 Long-term potentiation     102994715 (HRAS)    04730 Long-term depression     102994715 (HRAS)    04722 Neurotrophin signaling pathway     102994715 (HRAS)   09158 Development and regeneration    04360 Axon guidance     102994715 (HRAS)   09149 Aging    04211 Longevity regulating pathway     102994715 (HRAS)    04213 Longevity regulating pathway - multiple species     102994715 (HRAS)   09159 Environmental adaptation    04714 Thermogenesis     102994715 (HRAS)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     102994715 (HRAS)    05206 MicroRNAs in cancer     102994715 (HRAS)    05205 Proteoglycans in cancer     102994715 (HRAS)    05207 Chemical carcinogenesis - receptor activation     102994715 (HRAS)    05208 Chemical carcinogenesis - reactive oxygen species     102994715 (HRAS)    05203 Viral carcinogenesis     102994715 (HRAS)    05230 Central carbon metabolism in cancer     102994715 (HRAS)    05231 Choline metabolism in cancer     102994715 (HRAS)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     102994715 (HRAS)   09162 Cancer: specific types    05210 Colorectal cancer     102994715 (HRAS)    05225 Hepatocellular carcinoma     102994715 (HRAS)    05226 Gastric cancer     102994715 (HRAS)    05214 Glioma     102994715 (HRAS)    05216 Thyroid cancer     102994715 (HRAS)    05221 Acute myeloid leukemia     102994715 (HRAS)    05220 Chronic myeloid leukemia     102994715 (HRAS)    05218 Melanoma     102994715 (HRAS)    05211 Renal cell carcinoma     102994715 (HRAS)    05219 Bladder cancer     102994715 (HRAS)    05215 Prostate cancer     102994715 (HRAS)    05213 Endometrial cancer     102994715 (HRAS)    05224 Breast cancer     102994715 (HRAS)    05223 Non-small cell lung cancer     102994715 (HRAS)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     102994715 (HRAS)    05170 Human immunodeficiency virus 1 infection     102994715 (HRAS)    05161 Hepatitis B     102994715 (HRAS)    05160 Hepatitis C     102994715 (HRAS)    05163 Human cytomegalovirus infection     102994715 (HRAS)    05167 Kaposi sarcoma-associated herpesvirus infection     102994715 (HRAS)    05165 Human papillomavirus infection     102994715 (HRAS)   09171 Infectious disease: bacterial    05132 Salmonella infection     102994715 (HRAS)   09164 Neurodegenerative disease    05010 Alzheimer disease     102994715 (HRAS)    05022 Pathways of neurodegeneration - multiple diseases     102994715 (HRAS)   09165 Substance dependence    05034 Alcoholism     102994715 (HRAS)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     102994715 (HRAS)   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     102994715 (HRAS)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     102994715 (HRAS)    01522 Endocrine resistance     102994715 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:pcad04131]     102994715 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:pcad04147]     102994715 (HRAS)    04031 GTP-binding proteins [BR:pcad04031]     102994715 (HRAS) Membrane trafficking [BR:pcad04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     102994715 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     102994715 (HRAS) Exosome [BR:pcad04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    102994715 (HRAS)   Exosomal proteins of colorectal cancer cells    102994715 (HRAS) GTP-binding proteins [BR:pcad04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     102994715 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N G-alpha ATP_bind_1 Septin AAA_22 Ldh_1_N Motif Other DBs NCBI-GeneID:  102994715 NCBI-ProteinID:  XP_007108716 Ensembl:  ENSPCTG00005018089 UniProt:  A0A2Y9EVH5 LinkDB All DBs Position 18:4471539..4476163 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNAKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL AARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKARKLSPPDEGGPG CLSCRCLLS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctcgtggtggtgggcgctggaggcgtagggaagagcgccctgacc atccagctcatccagaaccactttgtggacgagtacgaccccaccatagaggactcctac cggaagcaagtggtcatcgatggggagacctgcctgctggacatcctggacacggcgggc caggaggagtacagcgccatgcgggaccagtacatgcgcaccggggagggcttcctttgt gtgtttgccatcaacaatgccaagtccttcgaggacatccaccagtacagggagcagatc aaacgggtgaaggactcggacgatgtgcccatggtgctggtggggaacaagtgtgacctg gccgcgcgcaccgtggagtctcggcaggcccaggacctcgcccgcagctacggcatcccc tatatcgagacgtcggccaagacgcgccagggcgtggaggatgccttctacacgctggtg cgcgagatccggcagcacaaggcgcgcaagctgagcccgcctgacgagggcggcccgggc tgcctgagctgcaggtgcctgctctcctga

DBGET integrated database retrieval system