KEGG   Physeter catodon (sperm whale): 102994734
Entry
102994734         CDS       T06011                                 

Gene name
RASSF1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X2
  KO
K09850  Ras association domain-containing protein 1
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04014  Ras signaling pathway
pcad04390  Hippo signaling pathway
pcad04392  Hippo signaling pathway - multiple species
pcad05200  Pathways in cancer
pcad05206  MicroRNAs in cancer
pcad05219  Bladder cancer
pcad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102994734 (RASSF1)
   04390 Hippo signaling pathway
    102994734 (RASSF1)
   04392 Hippo signaling pathway - multiple species
    102994734 (RASSF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102994734 (RASSF1)
   05206 MicroRNAs in cancer
    102994734 (RASSF1)
  09162 Cancer: specific types
   05219 Bladder cancer
    102994734 (RASSF1)
   05223 Non-small cell lung cancer
    102994734 (RASSF1)
SSDB
Motif
Pfam: RA Nore1-SARAH Mst1_SARAH
Other DBs
NCBI-GeneID: 102994734
NCBI-ProteinID: XP_007112213
UniProt: A0A2Y9F0P2
LinkDB
Position
Unknown
AA seq 272 aa
MGEADAGTPSFEMTWSSTTSSGYCSQEDSDSELEQYFTARTSLARRPRRDQDEPVEWETP
DLSQAEIEQKIKEYNGQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPASKKPPSLQDA
RRGPGRGTAVKRRTSFYLPKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERA
ERHGQVYLRKLSDDEQPLRLRLLAGPSEKALSFVLKENDSGEVNWDAFSMPELHNFLRIL
QREEEEHLRQILQKYSYCRQKIQEALHACPLG
NT seq 819 nt   +upstreamnt  +downstreamnt
atgggcgaggcggacgcggggactccctctttcgagatgacctggagtagcacgacaagc
agtggttactgcagccaggaagactcggactcagagctcgagcagtacttcacagcgcgt
acctcgctggcgcgcaggccgcgccgggatcaggatgagcccgtggagtgggagacacct
gacctttctcaggctgagattgagcagaagatcaaggagtacaatggccagatcaacagc
aacttattcatgagcctgaacaaggatggctcctacacaggcttcatcaaggttcaactg
aagctggtgcgccctgtctcagttcccgccagcaagaagccaccctccttgcaggatgcc
cggcggggcccagggcggggtacagctgtgaaacgccgcacctccttctacctgcccaag
gatgctgtcaagcacctgcatgtgttgtcacgcacacgggcacgcgaggtcatcgaggcc
ctgctgcgcaagttcttggtggtggatgacccccgcaagtttgctctttttgagcgggct
gagcgccatggccaagtgtacctccggaagctgtcagatgatgagcagcctctacggcta
cggctccttgcagggcccagtgagaaggccctaagctttgtcctgaaggagaatgactct
ggggaggtgaactgggatgctttcagcatgcctgagctacacaacttcctacgcatcctg
cagcgggaggaagaggaacatctccgccagatcctgcagaagtactcatattgccgccag
aagatccaggaagccctgcatgcctgccccctggggtga

DBGET integrated database retrieval system