KEGG   Physeter catodon (sperm whale): 102995201
Entry
102995201         CDS       T06011                                 

Gene name
RB1
Definition
(RefSeq) retinoblastoma-associated protein isoform X1
  KO
K06618  retinoblastoma-associated protein
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad04110  Cell cycle
pcad04218  Cellular senescence
pcad04934  Cushing syndrome
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05212  Pancreatic cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102995201 (RB1)
   04218 Cellular senescence
    102995201 (RB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102995201 (RB1)
   05203 Viral carcinogenesis
    102995201 (RB1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    102995201 (RB1)
   05225 Hepatocellular carcinoma
    102995201 (RB1)
   05226 Gastric cancer
    102995201 (RB1)
   05214 Glioma
    102995201 (RB1)
   05220 Chronic myeloid leukemia
    102995201 (RB1)
   05218 Melanoma
    102995201 (RB1)
   05219 Bladder cancer
    102995201 (RB1)
   05215 Prostate cancer
    102995201 (RB1)
   05224 Breast cancer
    102995201 (RB1)
   05222 Small cell lung cancer
    102995201 (RB1)
   05223 Non-small cell lung cancer
    102995201 (RB1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102995201 (RB1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102995201 (RB1)
   05161 Hepatitis B
    102995201 (RB1)
   05160 Hepatitis C
    102995201 (RB1)
   05163 Human cytomegalovirus infection
    102995201 (RB1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102995201 (RB1)
   05169 Epstein-Barr virus infection
    102995201 (RB1)
   05165 Human papillomavirus infection
    102995201 (RB1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102995201 (RB1)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102995201 (RB1)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Other transcription factors
   Pocket domain Rb
    102995201 (RB1)
SSDB
Motif
Pfam: RB_A Rb_C RB_B DUF3452 RuvC_1
Other DBs
NCBI-GeneID: 102995201
NCBI-ProteinID: XP_028353103
UniProt: A0A455BZ93
LinkDB
Position
13
AA seq 963 aa
MPPKTPRRAAAAAAAAAAAEPPPPPPPPPPEEDPEQDSGPEDLPLARLEFEETEEPDFTA
LCQKLKIPDHVRERAWLTWEKVSSVDGVLEGYVQKKKELWGICIFTAAVDLDEMPFTFTE
LQKNIETSVYKFFDLLKEIDTSTKVDNVMSRLLKKYNVLCALYSKLERTCELIYLSQPSS
SISTEINSMLVLKVSWLTFLLAKGQVLQMEDDLVISFQLMLCVLDYFIKLSPPALLKEPY
KTAVIPINGSPRTPRRGQNRSARIAKQLENDTRIIEVLCKEHECNIDEVKNVYFKNFIPF
MNSLGIVASNGLPEVESLSKQYEEIYLKNKDIDARLFLDHDKTLQADPTDSFEMQRTPRK
SNPDEEVNVILPQTPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRV
KDIGYIFKEKFAKAVGQGCMEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLND
NIFHMSLLACALEVVMATYSRSTSQNLDTGTDLSFPWILNVLNLKAFDFYKVIESFIKAE
ANLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQAKDREGPADHLEPACTLNLPLQNN
HTAADMYLSPVRSPKKKGSTTRVNSTANSEAQATSAFQTQKPLKSTSLSLFYKKVYRLAY
LRLNTLCARLLSDHPELEHIIWTLFQHTLQNEYELMRDRHLDQIMMCSMYGICKVKNIDL
KFKIIVTAYKDLPHAVQETFKRVLIREEEYDSIIVFYNSVFMQRLKTNILQYASTRPPTL
SPIPHIPRSPYKFSSSPLRVPGGNIYISPLKNPYKISEGLPVPTKMTPRSRILVSIGESF
GTSEKFQKINQMVCNSDRVLKRSAEGSNPPKPLKKLRFDIEGSDEADGSKHLPGESKFQQ
KLAEMRLSSEAFLDTQAKILPLYCATLLEKCNSIHHRQKLPDSGCLLPVYPPRHQPGWSY
LLL
NT seq 2892 nt   +upstreamnt  +downstreamnt
atgccgcccaaaaccccccgtagagcagcagccgccgccgccgccgccgccgccgcggag
cccccgccgccgcccccgccgccccctcctgaggaggaccccgagcaggacagcggcccc
gaggacctgcctctggccaggcttgagtttgaagaaactgaagaacctgattttactgca
ttatgtcagaaattaaagataccagatcatgtcagagaaagagcttggttaacttgggag
aaagtttcatctgtggatggagtcttggaaggttatgttcaaaagaaaaaggaactatgg
ggaatctgtatctttactgcagcagttgacctagatgagatgccgttcactttcactgag
ctgcagaaaaacattgaaaccagcgtctataaattttttgacttactaaaagaaatcgat
accagtaccaaagttgataatgttatgtcaagactgttgaagaagtataatgtgttatgt
gcactctacagcaaattagaaaggacatgtgaacttatatatttgtcacaacccagcagt
tcgatatctacggaaataaattctatgttggtgctaaaagtttcttggctcacattttta
ctagctaaagggcaagttttacaaatggaagatgatctggtgatctcatttcagttaatg
ctgtgtgtccttgactattttatcaagctctcacctcctgcattactcaaagaaccatat
aaaacagctgtaatacctattaatggttcacctcgaacaccaaggcgaggtcagaacagg
agtgcacggatagcaaaacaactagaaaatgatacaagaattattgaagttctctgtaaa
gaacatgaatgtaatatagatgaggtgaaaaatgtttatttcaaaaattttatacctttt
atgaattctcttggaattgtagcttctaatggacttccagaggtggaaagtctctctaaa
caatatgaagaaatttaccttaaaaacaaagatatagatgcaagattatttctggatcat
gataaaactcttcaggctgatcctacagacagttttgaaatgcagagaacaccacgaaaa
agtaaccccgatgaagaggtaaatgtgattcttccacagactccagttcggactgtcatg
aatactatccagcaattaatgatgatcttaaattcagcaagtgatcaaccgtcagaaaat
ctgatttcctattttaataattgcacagtgaatccaaaggaaagtatcctgaaaagagtg
aaggatattgggtacatctttaaagagaaatttgctaaagctgtgggacagggatgtatg
gaaattggatcccagcgatacaaacttggagtccgattgtattaccgagtaatggaatcc
atgcttaaatcagaagaagaacgattatccattcaaaattttagcaaactcctgaatgac
aacatctttcatatgtctttgttggcatgcgctcttgaggttgtaatggctacatatagc
agaagtacatctcagaatctggatactggaacagatttgtccttcccttggattctgaat
gtacttaatttaaaagcttttgatttttacaaggtgattgaaagttttatcaaagcagaa
gccaacttgaccagagaaatgattaaacatttagaacgatgtgaacatcgaatcatggaa
tcccttgcgtggctctcagattcacctttatttgatcttattaaacaagcaaaggaccga
gaaggaccagctgatcaccttgaacctgcttgtactctcaaccttcctctccagaataat
cacactgcagcagatatgtatctttctcctgtaagatccccaaagaaaaaagggtcaact
acacgtgtaaattctactgcaaattcagaggcacaagcaacctcagccttccagactcag
aagccattgaaatctacctccctttcactcttttacaaaaaagtgtatcgactagcatat
cttcgactaaataccctgtgtgcacgccttctgtctgaccacccagaactagaacatatc
atctggacccttttccaacacacactgcaaaatgagtatgaactcatgagagacaggcat
ttggaccagattatgatgtgttccatgtatggcatatgcaaagtgaagaatatagacctt
aaattcaaaatcattgtaacagcatacaaagatcttcctcatgctgttcaggagacattc
aaacgtgttttgatcagagaagaggagtatgattctattatcgtattctataattcagtc
ttcatgcagagactgaaaacaaatattttgcagtatgcttccaccaggccccctaccttg
tcaccaattcctcacattcctcgaagcccttacaagttttctagctcacctttacgggtt
cctggggggaacatatacatatcacccctgaagaatccgtataaaatttcagaaggtctg
cctgtgccaacaaaaatgactccaagatcaagaatcttagtatcaattggtgaatcattt
gggacttctgagaagttccagaaaataaatcaaatggtgtgtaacagcgaccgtgtgctc
aaaagaagtgctgaaggaagcaaccctcctaaaccactgaaaaaactgcgcttcgacatt
gaaggatcggatgaagcagatggaagtaaacatctcccaggcgagtccaaatttcaacag
aaactggcagaaatgaggctcagctcagaggccttccttgacacccaagctaaaatcctt
cctctgtactgtgccactctccttgaaaagtgtaacagcattcatcaccgtcagaaactg
cctgactcgggctgcctattgcctgtttacccaccccggcatcaacctggctggtcttac
ctactactatag

DBGET integrated database retrieval system