KEGG   Physeter catodon (sperm whale): 102995437
Entry
102995437         CDS       T06011                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01522  Endocrine resistance
pcad01524  Platinum drug resistance
pcad04012  ErbB signaling pathway
pcad04066  HIF-1 signaling pathway
pcad04068  FoxO signaling pathway
pcad04110  Cell cycle
pcad04115  p53 signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04218  Cellular senescence
pcad04630  JAK-STAT signaling pathway
pcad04921  Oxytocin signaling pathway
pcad04928  Parathyroid hormone synthesis, secretion and action
pcad04934  Cushing syndrome
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05166  Human T-cell leukemia virus 1 infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05169  Epstein-Barr virus infection
pcad05200  Pathways in cancer
pcad05202  Transcriptional misregulation in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05212  Pancreatic cancer
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05216  Thyroid cancer
pcad05217  Basal cell carcinoma
pcad05218  Melanoma
pcad05219  Bladder cancer
pcad05220  Chronic myeloid leukemia
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    102995437 (CDKN1A)
   04630 JAK-STAT signaling pathway
    102995437 (CDKN1A)
   04066 HIF-1 signaling pathway
    102995437 (CDKN1A)
   04068 FoxO signaling pathway
    102995437 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    102995437 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102995437 (CDKN1A)
   04115 p53 signaling pathway
    102995437 (CDKN1A)
   04218 Cellular senescence
    102995437 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    102995437 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    102995437 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102995437 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    102995437 (CDKN1A)
   05206 MicroRNAs in cancer
    102995437 (CDKN1A)
   05205 Proteoglycans in cancer
    102995437 (CDKN1A)
   05203 Viral carcinogenesis
    102995437 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    102995437 (CDKN1A)
   05212 Pancreatic cancer
    102995437 (CDKN1A)
   05225 Hepatocellular carcinoma
    102995437 (CDKN1A)
   05226 Gastric cancer
    102995437 (CDKN1A)
   05214 Glioma
    102995437 (CDKN1A)
   05216 Thyroid cancer
    102995437 (CDKN1A)
   05220 Chronic myeloid leukemia
    102995437 (CDKN1A)
   05217 Basal cell carcinoma
    102995437 (CDKN1A)
   05218 Melanoma
    102995437 (CDKN1A)
   05211 Renal cell carcinoma
    102995437 (CDKN1A)
   05219 Bladder cancer
    102995437 (CDKN1A)
   05215 Prostate cancer
    102995437 (CDKN1A)
   05213 Endometrial cancer
    102995437 (CDKN1A)
   05224 Breast cancer
    102995437 (CDKN1A)
   05222 Small cell lung cancer
    102995437 (CDKN1A)
   05223 Non-small cell lung cancer
    102995437 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    102995437 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    102995437 (CDKN1A)
   05161 Hepatitis B
    102995437 (CDKN1A)
   05160 Hepatitis C
    102995437 (CDKN1A)
   05163 Human cytomegalovirus infection
    102995437 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102995437 (CDKN1A)
   05169 Epstein-Barr virus infection
    102995437 (CDKN1A)
   05165 Human papillomavirus infection
    102995437 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102995437 (CDKN1A)
   01522 Endocrine resistance
    102995437 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 102995437
NCBI-ProteinID: XP_007105429
UniProt: A0A2Y9ENU9
LinkDB
Position
18
AA seq 164 aa
MSEPSRDAHQIPRSSKACRRLFGPVDSEQLRRDCDALMASCVQEARERWNFDFVTETPLE
GDFAWERVRGLGLPKLYLPAGPRGTRDDLGGGKWPSTSSALLQGTSQEDHVDLSLSCTLV
PRSPERAEGSPGGPGTSQGRKRRQTSMTDFYHSKRRLISSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagagccatccagggacgcccatcagatcccacgcagcagcaaggcgtgccgccgc
ctctttggcccggtggacagtgagcagctgcgccgggactgcgacgccctgatggccagc
tgtgtgcaggaggcccgagagcgatggaacttcgactttgtcactgagacaccactggag
ggtgacttcgcctgggagcgcgtgaggggccttggcctgcccaagctctacctgcctgca
gggccccgggggacccgggacgacctgggagggggcaagtggccgagcacctcatctgcc
ctgctgcaggggacatctcaggaggaccacgtggacctgtcgctgtcctgcaccctcgtg
cctcgctcccctgagcgggctgaggggtccccgggagggccgggcacctcccagggacga
aaacggcgacagaccagcatgacagatttctatcactctaaacgccggctgatcagctcc
aagaggaagccctaa

DBGET integrated database retrieval system