KEGG   Physeter catodon (sperm whale): 102995557Help
Entry
102995557         CDS       T06011                                 

Gene name
CHP1
Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
pcad  Physeter catodon (sperm whale)
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcad01009]
    102995557 (CHP1)
Protein phosphatases and associated proteins [BR:pcad01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     102995557 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 102995557
NCBI-ProteinID: XP_007111764
UniProt: A0A2Y9EZX6
LinkDB All DBs
Position
11
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtcccgggcctccacgttactgcgggacgaagagctcgaggagatcaagaaggaa
actggcttttcccacagtcagatcacccgcctctacagccggttcaccagcctggacaaa
ggagagaatgggactctcagccgggaagactttcagcggattccagaacttgccatcaac
ccattaggggaccggatcatcaatgccttctttccagagggagaggaccaggtaaacttc
cgcggattcatgaggaccttggctcatttccgacccattgaggataatgaaaagagcaaa
gatgtgaatggaccagaaccactcaacagccgaagcaacaaactgcactttgcttttcga
ctgtatgacttggataaagatgacaagatctcccgtgatgagctgttacaggtgctacgc
atgatggtcggagtgaatatctcagatgagcagctgggcagcatcgcagacaggactatc
caggaggctgatcaggatggggacagcgccatatctttcacagaatttgttaaggttttg
gagaaggtggacgtagaacagaaaatgagcatccgatttcttcactaa

DBGET integrated database retrieval system