KEGG   Physeter catodon (sperm whale): 102995774
Entry
102995774         CDS       T06011                                 

Gene name
RASSF5
Definition
(RefSeq) ras association domain-containing protein 5
  KO
K08015  Ras association domain-containing protein 5
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04014  Ras signaling pathway
pcad04015  Rap1 signaling pathway
pcad04218  Cellular senescence
pcad04670  Leukocyte transendothelial migration
pcad05200  Pathways in cancer
pcad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    102995774 (RASSF5)
   04015 Rap1 signaling pathway
    102995774 (RASSF5)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    102995774 (RASSF5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    102995774 (RASSF5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102995774 (RASSF5)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102995774 (RASSF5)
SSDB
Motif
Pfam: Nore1-SARAH RA
Other DBs
NCBI-GeneID: 102995774
NCBI-ProteinID: XP_028341664
UniProt: A0A455AZK1
LinkDB
Position
Unknown
AA seq 230 aa
MAVFCNDCKPAEEPWCPPTLQEIKQMIDSYNTREKNCLGMKLSEDGTYTGFIKVHLKLRR
PVMVPAGIRPPSIYDAIKEVDLAATTDKRTSFYLPLDAIKQLHISSTTTVSEVIQGLLKK
FMVVDNPQKFALFKRIHKDGQVLFQKLSVADCPLYLRLLAGPDTDVLSFVLKENETGEVE
WDAFSIPELQNFLTILGKEEQDKIQQVQKKYDNFRQKLEEALRESQVKPA
NT seq 693 nt   +upstreamnt  +downstreamnt
atggctgttttctgcaatgactgtaaacccgcagaggagccgtggtgcccgcccacgctg
caggagatcaagcagatgatcgacagctacaacacccgggaaaagaactgcctcggcatg
aagttgagtgaagatggcacctacacgggtttcatcaaagtgcatttgaaacttcggcgg
ccggtgatggtgcctgctgggatccggcccccgtccatctatgacgccatcaaggaagtg
gacctggcagccaccacggacaagcggacgtccttctacctgccgctggacgccatcaag
cagctgcacatcagcagtaccaccacggtcagtgaggtcatccaggggctgctcaagaag
ttcatggtcgtggacaatccccagaagtttgcactttttaagcggatacacaaggacggg
caagtgctcttccagaaactctccgttgctgactgccccctctacctgcgcttactcgct
gggcctgacacggacgtgctcagcttcgtgctaaaggagaacgaaactggagaggtggag
tgggatgccttctccatccccgagctccagaacttcctaacaatcctgggaaaagaggag
caggacaaaatccaacaagtgcagaagaagtatgacaactttaggcagaaactggaggag
gccttaagagaatcccaggtcaaacctgcctag

DBGET integrated database retrieval system