KEGG   Physeter catodon (sperm whale): 102995999
Entry
102995999         CDS       T06011                                 

Gene name
FHIT
Definition
(RefSeq) bis(5'-adenosyl)-triphosphatase isoform X1
  KO
K01522  bis(5'-adenosyl)-triphosphatase [EC:3.6.1.29]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad00230  Purine metabolism
pcad01100  Metabolic pathways
pcad05222  Small cell lung cancer
pcad05223  Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    102995999 (FHIT)
 09160 Human Diseases
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102995999 (FHIT)
   05223 Non-small cell lung cancer
    102995999 (FHIT)
Enzymes [BR:pcad01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.29  bis(5'-adenosyl)-triphosphatase
     102995999 (FHIT)
SSDB
Motif
Pfam: HIT DcpS_C OTCace_N
Other DBs
NCBI-GeneID: 102995999
NCBI-ProteinID: XP_028334354
UniProt: A0A455AF23
LinkDB
Position
18
AA seq 171 aa
MHPAVERSEEVTVFRENSNREEMSFRFGQHLIKPSVVFLKTELSFALVNRKPVVPGHVLV
CPLRPVERFRDLRPNEVADLFQAAQRVGTAVEKHFQGTSLTFSVQDGPEAGQTVKHVHIH
VLPRKAGDFRRNDSIYDELQKHDKEKEDSPPSWRSEEEMAAEAAALRGYFQ
NT seq 516 nt   +upstreamnt  +downstreamnt
atgcaccctgctgttgagcgctctgaggaggtaacagtattcagagagaattcaaaccgt
gaggaaatgtcattcagatttggccaacatctcatcaagccctctgtggtgtttctcaaa
acagaactgtccttcgccctggtgaacaggaaacctgtggtacctggacatgtcctcgtg
tgtcccctccggccagtggagcgcttccgagacctgcgtcccaatgaagtggccgacctg
tttcaggcagcacagagagtcgggacggcagtggagaagcatttccagggcacctctctc
accttttccgtgcaggatggccccgaagccggacaaactgtgaagcacgttcacatccac
gttctcccaaggaaggctggagactttcgcaggaatgacagcatctatgatgagctccag
aaacatgacaaagagaaggaggactccccaccctcgtggagatcggaggaggagatggca
gccgaagctgcggcgctgcggggctactttcagtga

DBGET integrated database retrieval system