KEGG   Physeter catodon (sperm whale): 102996029
Entry
102996029         CDS       T06011                                 

Gene name
NR3C1
Definition
(RefSeq) glucocorticoid receptor isoform X1
  KO
K05771  glucocorticoid receptor
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    102996029 (NR3C1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcad03000]
    102996029 (NR3C1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:pcad03310]
    102996029 (NR3C1)
Transcription factors [BR:pcad03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    102996029 (NR3C1)
Nuclear receptors [BR:pcad03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   102996029 (NR3C1)
SSDB
Motif
Pfam: GCR Hormone_recep zf-C4 SCA7
Other DBs
NCBI-GeneID: 102996029
NCBI-ProteinID: XP_023980539
UniProt: A0A2Y9SXQ5
LinkDB
Position
8
AA seq 781 aa
MDPKESLNPPSKEIPSSVLGRERGNVMDFYKTLRGGATVKVSASSPSLAAASQADSKQQR
LLVDFPKGSGSNVQQPDLSKAVSLSMGLYMGETETKVMGNDLGFPQQGQMSLSSGETDFR
LLEESIANLNRSTSVAENPKNSASAAASAAPTEKEFPKTHSDVSSEQQNLKGQTGTNGGN
VKLYTTDQSTFDIWRKKLQDLEFSSGSPGKETSESPWSSDLLIDENCLLSPLAGEDDPFL
LEGNSKEDCKPLVLPDTKPKIKDNGDLILSSPNSVPLPQVKTEKEDFIELCTPGVIKQEK
LGPVYCQASFSGANIIGNKMSAISVHGVSTSGGQMYHYDMNTASLSQQQDQKPIFNVIPP
IPVGSENWNRCQGSGDDNLTSLGTLNFSGRSVFSNGYSSPGMRPDVSSPPSSSSAATGPP
PKLCLVCSDEASGCHYGVLTCGSCKVFFKRAVEGRQHNYLCAGRNDCIIDKIRRKNCPAC
RYRKCLQAGMNLEARKTKKKIKGIQQATTGVSQETSENSANKTIVPATLPQLTPTLVSLL
EVIEPEVIYAGYDSSIPDTTWRIMTTLNMLGGRQVIAAVKWAKAIPGFRNLHLDDQMTLL
QYSWMFLMSFALGWRSYRQSSSNLLCFAPDLIINEQRMALPCMYDQCKHMLYVSSELNRL
QVSYEEYLCMKTLLLLSSVPKEGLKSQELFDEIRMTYIKELGKAIVKREGNSSQNWQRFY
QLTKLLDSMHDVVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSSGNIKKLLFHQ
K
NT seq 2346 nt   +upstreamnt  +downstreamnt
atggaccccaaggaatcattaaacccccccagtaaagaaatccccagcagtgtgcttggt
cgagagaggggaaatgtgatggacttctataaaaccctaaggggaggagctactgtgaag
gtttctgcatcttcaccctcactggctgctgcttctcaggcagactccaagcagcagaga
cttttggttgattttccgaaaggctcaggaagcaatgtgcagcagccagatctgtccaag
gcagtttcactctcaatgggactgtatatgggagagacagagacaaaagtaatgggaaat
gacctgggattcccacagcagggccaaatgagtctttcctctggggaaacagactttcgg
cttctggaagaaagcatcgcaaacctcaataggtcgaccagtgttgcagagaaccccaag
aattcagcatcagctgctgcctctgctgcccccacagagaaggagtttccaaaaactcac
tctgatgtatcttcagaacagcagaatttgaagggccagactggcactaatgggggtaat
gtgaagttgtataccacagaccaaagcacctttgacatatggaggaaaaaactccaggat
ttggagttttcttctggttccccaggtaaagagacaagtgagagtccttggagctcagac
ctcttgatagatgaaaactgtttgctttctcctttggcaggagaggatgatccattcctt
ctggaaggaaactcaaaagaggactgtaagcctcttgttttaccggacactaaacctaaa
attaaggataatggagatctgatcttatcaagccctaacagtgtgccactgccccaagtg
aaaacagaaaaagaagattttatcgaactctgcacccctggagtaattaagcaggagaaa
ctgggcccagtttattgtcaggccagcttttctggagcaaatataattggtaataaaatg
tctgccatttctgttcatggtgtgagtacctctgggggacagatgtaccactatgacatg
aatacagcatccctttctcaacagcaggatcagaaacctatttttaatgtcattccacca
attcctgttggttcagaaaattggaatagatgccaaggatctggagatgataacttgact
tccttggggactttgaacttctccggtcgatcggttttttctaatggctattcaagccct
ggaatgagaccagatgtaagctctcctccatccagctcctcagcagcaacgggaccacct
cccaaactctgcctagtgtgctctgatgaagcttcgggatgtcattatggggtcttaact
tgtggaagctgtaaagtattcttcaaaagagcagtggaaggtagacagcacaattatctt
tgtgctggaagaaatgattgcatcattgataaaattcgaagaaaaaactgcccagcatgc
cgctatagaaaatgtcttcaagcaggaatgaacctggaagctcgaaaaacaaagaaaaag
ataaaaggaattcagcaggccactacaggagtgtcacaagaaacttctgaaaattctgct
aacaaaacaatagtccctgcaacgttaccgcaactcacccctaccctggtgtcactgctg
gaggtcattgagccggaggtgatatatgcgggctacgacagctccattccagatacaact
tggcggatcatgactacactcaacatgttgggtggacggcaggtgatcgcagctgtgaaa
tgggcgaaggcgataccaggattcaggaacttacatctggatgaccaaatgaccctactg
caatattcatggatgttcctcatgtcattcgccctggggtggagatcatatagacaatca
agttcaaacttgctgtgttttgctcctgatctgattattaatgagcagagaatggcttta
ccctgcatgtatgaccaatgtaaacatatgctatatgtttcctctgagttaaacagactt
caggtatcttatgaagagtatctctgtatgaaaaccttactgcttctctcttcagttcct
aaggaaggtttgaagagtcaagagttatttgatgaaattagaatgacctacatcaaagag
ctaggaaaagccattgtcaagagggaaggaaactccagtcagaactggcagcggttttac
caactgacaaaactcttggactccatgcatgatgtggttgaaaatctccttaactattgc
ttccaaacatttttggataagaccatgagtattgaattcccagagatgttagctgaaatc
atcaccaatcagataccaaaatattcaagtggaaatatcaaaaaacttctgtttcatcaa
aagtga

DBGET integrated database retrieval system