KEGG   Physeter catodon (sperm whale): 102996185Help
Entry
102996185         CDS       T06011                                 

Gene name
TRAF2
Definition
(RefSeq) TNF receptor-associated factor 2 isoform X1
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad04010  MAPK signaling pathway
pcad04064  NF-kappa B signaling pathway
pcad04071  Sphingolipid signaling pathway
pcad04141  Protein processing in endoplasmic reticulum
pcad04210  Apoptosis
pcad04217  Necroptosis
pcad04380  Osteoclast differentiation
pcad04621  NOD-like receptor signaling pathway
pcad04622  RIG-I-like receptor signaling pathway
pcad04657  IL-17 signaling pathway
pcad04668  TNF signaling pathway
pcad04920  Adipocytokine signaling pathway
pcad04932  Non-alcoholic fatty liver disease (NAFLD)
pcad05135  Yersinia infection
pcad05160  Hepatitis C
pcad05163  Human cytomegalovirus infection
pcad05167  Kaposi sarcoma-associated herpesvirus infection
pcad05168  Herpes simplex virus 1 infection
pcad05169  Epstein-Barr virus infection
pcad05170  Human immunodeficiency virus 1 infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    102996185 (TRAF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102996185 (TRAF2)
   04064 NF-kappa B signaling pathway
    102996185 (TRAF2)
   04668 TNF signaling pathway
    102996185 (TRAF2)
   04071 Sphingolipid signaling pathway
    102996185 (TRAF2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    102996185 (TRAF2)
   04217 Necroptosis
    102996185 (TRAF2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    102996185 (TRAF2)
   04622 RIG-I-like receptor signaling pathway
    102996185 (TRAF2)
   04657 IL-17 signaling pathway
    102996185 (TRAF2)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    102996185 (TRAF2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    102996185 (TRAF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102996185 (TRAF2)
   05203 Viral carcinogenesis
    102996185 (TRAF2)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    102996185 (TRAF2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102996185 (TRAF2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    102996185 (TRAF2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    102996185 (TRAF2)
   05160 Hepatitis C
    102996185 (TRAF2)
   05168 Herpes simplex virus 1 infection
    102996185 (TRAF2)
   05163 Human cytomegalovirus infection
    102996185 (TRAF2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102996185 (TRAF2)
   05169 Epstein-Barr virus infection
    102996185 (TRAF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcad03019]
    102996185 (TRAF2)
   04121 Ubiquitin system [BR:pcad04121]
    102996185 (TRAF2)
Enzymes [BR:pcad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     102996185 (TRAF2)
Messenger RNA biogenesis [BR:pcad03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     102996185 (TRAF2)
Ubiquitin system [BR:pcad04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    102996185 (TRAF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4 zf-RING_6 zf-C3HC4_2 zf-C3HC4_4 zf-RING_UBOX zf-RING_2 zf-C3HC4_5 zf_C2HC_14 SlyX
Motif
Other DBs
NCBI-GeneID: 102996185
NCBI-ProteinID: XP_028353453
UniProt: A0A455C0D2
LinkDB All DBs
Position
13
AA seq 594 aa AA seqDB search
MAAASATPPGSLDLLQPGFSKTLLGTKLEDKYLCSACRNVLRRPFQAQCGHRYCSSCLSG
ILSSGPQNCAACVNEGIYEEGISILESSSAFPDNAARREVESLPAVCSSEGCTWKGTLKE
YESCHEGHCPFMLTECPACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCLADMKAHHQ
VCPKFPLTCEGCGKKKITREKFQDHVRTCGRCRVPCRFHAVGCPEMVEGERLQEHEAQRL
REHLALLLGVLLEAGPHPGDGRPLLGQGEQGWAASTPDAGAAPSKAAELLQRCEALERKT
ATFENIVCVLNREVERVAMTAEACGRQHRLDQDRIEALSNKVQQLERSIGLKDLAVADLG
QKVHDMEASTFDGVFIWKIPDFARKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRAYLNGD
GTGRGTHLSLFFVLMKGPHDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRP
VSDMNIASGCPLFCPVSKMEAKNSYVASPQDQDLPGLQVFPRQRQSPGSLSTGLHLGWTR
SGPQPGAAGWARRPGRQLATPRCASDQDWVLKSRSPYREPVTTLSLLYFEKLKN
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggctgcggccagcgcgacccctcccggctccctggacctgctgcagcctggcttctcc
aagaccctcctggggacgaagctagaggacaagtacctgtgctcggcctgcaggaacgtc
ctgcgcaggcccttccaggctcagtgtggccaccgctactgctcctcctgcctgagcggc
atcctgagctccgggccccagaactgtgccgcctgcgtgaacgagggcatttacgaggaa
ggcatctctatcctggagagcagctcagctttcccggacaatgctgcccgcagggaggtg
gagagcttgccggccgtctgttccagcgagggctgcacctggaaggggaccctgaaggag
tacgagagctgccacgaaggacactgcccgttcatgctgaccgagtgcccggcgtgtaaa
ggcctggtgcgcctgggtgagaaggaacgccacctggagcatgagtgcccggagagaagc
ctcagctgccggcactgcagggcgccctgctgcctggctgacatgaaggcgcaccaccag
gtctgccccaagttccccttgacctgcgagggctgcggcaagaagaagatcacacgcgag
aaatttcaggaccacgtcaggacgtgtggcagatgccgagtgccctgcaggttccacgct
gtcggctgccccgagatggtggagggcgagaggctgcaggagcacgaggcacagcggctc
cgggaacacctggcgctgctcctgggcgtcctcctggaggccgggccccaccctggagac
ggccgccccctcctcggccagggcgagcagggctgggcggccagcacgccggacgcgggg
gcagcgccctccaaggcggcggagctgctgcagaggtgcgaggccctggagcggaagacg
gccaccttcgagaatatcgtctgcgtgctgaaccgggaggtggagcgggtggccatgacc
gccgaggcctgcggccggcagcaccggctggaccaagacaggatcgaagcgctgagtaac
aaggtgcaacagctggagaggagcatcggcctgaaggacctggctgtggccgacctgggg
cagaaggtccacgacatggaggcgtccaccttcgacggggtgttcatctggaagatcccg
gacttcgccaggaagcgccaggaggctgtggctggccgcacgcccgccatcttctcccca
gccttctacaccagcaggtacggctacaagatgtgtctgcgcgcctacctgaacggagac
ggcaccgggcgcgggacgcacctgtccctcttcttcgtgctgatgaagggcccccacgac
gccctcctgcgctggcccttcaaccagaaggtgaccctgatgttgctggaccagaacaac
cgggagcacgtgattgacgccttcaggcccgatgtgacctcgtcctctttccagaggccg
gtcagcgacatgaacatcgcgagcggctgcccgcttttctgccccgtctccaagatggag
gccaagaattcctacgtggcgtctccccaggaccaggacttgcctggcctccaggtgttt
cctcgacagcggcagagcccgggcagcctgagcacaggcttgcacctcggctggacccgg
tcagggcctcagcccggggctgcaggatgggcacggcgtcctggccggcagctggccaca
cccaggtgcgctagtgaccaggactgggtgcttaagagccggagtccttacagagaacct
gtgacaacattgtcacttctctattttgagaagttaaagaattga

DBGET integrated database retrieval system