KEGG   Physeter catodon (sperm whale): 114483947
Entry
114483947         CDS       T06011                                 

Gene name
GRB2
Definition
(RefSeq) growth factor receptor-bound protein 2
  KO
K04364  growth factor receptor-bound protein 2
Organism
pcad  Physeter catodon (sperm whale)
Pathway
pcad01521  EGFR tyrosine kinase inhibitor resistance
pcad01522  Endocrine resistance
pcad04010  MAPK signaling pathway
pcad04012  ErbB signaling pathway
pcad04014  Ras signaling pathway
pcad04062  Chemokine signaling pathway
pcad04068  FoxO signaling pathway
pcad04072  Phospholipase D signaling pathway
pcad04150  mTOR signaling pathway
pcad04151  PI3K-Akt signaling pathway
pcad04380  Osteoclast differentiation
pcad04510  Focal adhesion
pcad04540  Gap junction
pcad04550  Signaling pathways regulating pluripotency of stem cells
pcad04630  JAK-STAT signaling pathway
pcad04650  Natural killer cell mediated cytotoxicity
pcad04660  T cell receptor signaling pathway
pcad04662  B cell receptor signaling pathway
pcad04664  Fc epsilon RI signaling pathway
pcad04714  Thermogenesis
pcad04722  Neurotrophin signaling pathway
pcad04910  Insulin signaling pathway
pcad04912  GnRH signaling pathway
pcad04915  Estrogen signaling pathway
pcad04917  Prolactin signaling pathway
pcad04926  Relaxin signaling pathway
pcad04935  Growth hormone synthesis, secretion and action
pcad05034  Alcoholism
pcad05160  Hepatitis C
pcad05161  Hepatitis B
pcad05163  Human cytomegalovirus infection
pcad05165  Human papillomavirus infection
pcad05200  Pathways in cancer
pcad05203  Viral carcinogenesis
pcad05205  Proteoglycans in cancer
pcad05206  MicroRNAs in cancer
pcad05210  Colorectal cancer
pcad05211  Renal cell carcinoma
pcad05213  Endometrial cancer
pcad05214  Glioma
pcad05215  Prostate cancer
pcad05220  Chronic myeloid leukemia
pcad05221  Acute myeloid leukemia
pcad05223  Non-small cell lung cancer
pcad05224  Breast cancer
pcad05225  Hepatocellular carcinoma
pcad05226  Gastric cancer
pcad05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pcad00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114483947 (GRB2)
   04012 ErbB signaling pathway
    114483947 (GRB2)
   04014 Ras signaling pathway
    114483947 (GRB2)
   04630 JAK-STAT signaling pathway
    114483947 (GRB2)
   04068 FoxO signaling pathway
    114483947 (GRB2)
   04072 Phospholipase D signaling pathway
    114483947 (GRB2)
   04151 PI3K-Akt signaling pathway
    114483947 (GRB2)
   04150 mTOR signaling pathway
    114483947 (GRB2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    114483947 (GRB2)
   04540 Gap junction
    114483947 (GRB2)
   04550 Signaling pathways regulating pluripotency of stem cells
    114483947 (GRB2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    114483947 (GRB2)
   04660 T cell receptor signaling pathway
    114483947 (GRB2)
   04662 B cell receptor signaling pathway
    114483947 (GRB2)
   04664 Fc epsilon RI signaling pathway
    114483947 (GRB2)
   04062 Chemokine signaling pathway
    114483947 (GRB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    114483947 (GRB2)
   04912 GnRH signaling pathway
    114483947 (GRB2)
   04915 Estrogen signaling pathway
    114483947 (GRB2)
   04917 Prolactin signaling pathway
    114483947 (GRB2)
   04926 Relaxin signaling pathway
    114483947 (GRB2)
   04935 Growth hormone synthesis, secretion and action
    114483947 (GRB2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    114483947 (GRB2)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    114483947 (GRB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    114483947 (GRB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    114483947 (GRB2)
   05206 MicroRNAs in cancer
    114483947 (GRB2)
   05205 Proteoglycans in cancer
    114483947 (GRB2)
   05203 Viral carcinogenesis
    114483947 (GRB2)
   05231 Choline metabolism in cancer
    114483947 (GRB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    114483947 (GRB2)
   05225 Hepatocellular carcinoma
    114483947 (GRB2)
   05226 Gastric cancer
    114483947 (GRB2)
   05214 Glioma
    114483947 (GRB2)
   05221 Acute myeloid leukemia
    114483947 (GRB2)
   05220 Chronic myeloid leukemia
    114483947 (GRB2)
   05211 Renal cell carcinoma
    114483947 (GRB2)
   05215 Prostate cancer
    114483947 (GRB2)
   05213 Endometrial cancer
    114483947 (GRB2)
   05224 Breast cancer
    114483947 (GRB2)
   05223 Non-small cell lung cancer
    114483947 (GRB2)
  09165 Substance dependence
   05034 Alcoholism
    114483947 (GRB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    114483947 (GRB2)
   05160 Hepatitis C
    114483947 (GRB2)
   05163 Human cytomegalovirus infection
    114483947 (GRB2)
   05165 Human papillomavirus infection
    114483947 (GRB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    114483947 (GRB2)
   01522 Endocrine resistance
    114483947 (GRB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcad04131]
    114483947 (GRB2)
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pcad04990]
    114483947 (GRB2)
Membrane trafficking [BR:pcad04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Receptor tyrosine kinase (RTK) adaptor proteins
    114483947 (GRB2)
Domain-containing proteins not elsewhere classified [BR:pcad04990]
 Src homology (SH) domain-containing proteins
  Signal transducing adaptor proteins
   114483947 (GRB2)
SSDB
Motif
Pfam: SH2 DUF5093
Other DBs
NCBI-GeneID: 114483947
NCBI-ProteinID: XP_028340164
UniProt: A0A455AVF7
LinkDB
Position
Unknown
AA seq 175 aa
PGQSPLAYSHVYPPLPLPRFGNDVQHFKVLRDGAGKYFLWVVKFNSLNELVDYHRSTSVS
RNQQIFLRDIEQVPQPDSTPWYGDTLPFLSVRTVMSTGVVSTLWLPVNDAAADIHVRGFM
RTHPGGFEAEEQTQSCLARKVEKGSHGRDPLVPCPQTAQHVFPLLLRDLPPLPGY
NT seq 528 nt   +upstreamnt  +downstreamnt
ccgggacagagccctctggcctattctcacgtgtatcctcctctacccctccccaggttt
ggaaatgatgtacagcacttcaaggtgctccgagatggggctggaaagtatttcctctgg
gtggtcaagttcaattctttgaatgagctggtagattatcacagatctacatccgtctcc
agaaaccagcagatatttctccgggacatagagcaggtgccacagccggatagcactccc
tggtatggagacaccctgccttttttatccgttcgtacagtgatgagcactggggttgtt
tccactctttggctgcccgtaaacgatgctgctgcagacattcacgtgcgaggttttatg
aggacacaccctggagggtttgaagcagaggagcagacacagtcctgtttggctagaaaa
gtggagaaagggagccacggaagagaccccctggtcccgtgtccccagactgcccagcac
gtcttccctcttctgctgagagaccttcccccgctgccaggttattga

DBGET integrated database retrieval system