KEGG   Paraburkholderia caffeinilytica: DSC91_002024
Entry
DSC91_002024      CDS       T06448                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
pcaf  Paraburkholderia caffeinilytica
Pathway
pcaf00440  Phosphonate and phosphinate metabolism
pcaf00998  Biosynthesis of various secondary metabolites - part 2
pcaf01100  Metabolic pathways
pcaf01110  Biosynthesis of secondary metabolites
pcaf01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcaf00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    DSC91_002024
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various secondary metabolites - part 2
    DSC91_002024
Enzymes [BR:pcaf01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     DSC91_002024
SSDB
Motif
Pfam: PEP_mutase NTP_transf_3 ICL IspD NTP_transferase NAD_binding_7 CTP_transf_3
Other DBs
NCBI-ProteinID: AXL50008
UniProt: A0A346B9T9
LinkDB
Position
1:complement(2181400..2183133)
AA seq 577 aa
MNAREPAFVSASRSARLRQMLVSNELEFMMEAHNGLSARIVREAGFKAIWGSGLAISAQF
GVRDNNEASWTQVVDNLEFMADASDLPILLDGDTGYGNFNNVRRLVRKLEQRGIAGVCIE
DKQFPKTNSFINGEAQPLADMDEFCGKIKAGKDSQSDENFSIVARVEALIAGWGMDEALR
RAEAYRQAGADAILIHSKLSRPDEILEFAREWAGRGPLVIVPTKYYSTPTEVFREAGIST
VIWANHLIRAATSAMQAVAKDIHSSETLVNVEDSIAAVNEIFRLQDADEYSEAEDRYLSS
GRAAGAAIVLAASRGKGLEAVTEDRPKVMLPIAGKPLLRWLIDAFKKQSVNDITVVGGYR
ADAIDTAGIKLVVNERHAQTGELASLACAVRGEVDKLAGDTVISYGDLLFRSYILRDLVE
SEATFSVVVDSSLTDAENASVRDFAWCSAADDRGLFGNKVTLRHVSSGQGASSAIASQTP
HGRWVGLLNVRGEGLERLQAVLGKLQARPDFDSLDMPALLNALIEAGESIEVQYVHGHWR
GVNDLEDFRRAGDFAHAQAPFAAAVGKQTNAASGAAQ
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgaacgcccgcgaacctgctttcgtctccgcgtcccgcagcgcgcgtctgcgccagatg
ctcgtgagcaacgaactcgaattcatgatggaggcccacaacggtctctccgcccgcatc
gtccgcgaagccggattcaaggcgatctggggttcgggcctcgcgatctccgcccaattc
ggcgtgcgcgacaacaatgaagccagctggacgcaagtcgtcgacaacctcgaattcatg
gccgacgccagcgatctgcccatcctcctcgatggcgataccggctacggcaacttcaac
aacgtgcgacgcctcgtgcgcaagctcgaacaacgcggcattgccggcgtctgcatcgaa
gacaaacaattcccgaaaacgaatagcttcatcaacggcgaggcgcagccgctcgccgat
atggacgagttctgcggcaagatcaaagccggtaaagactcgcagtccgatgaaaatttc
tcgatcgtcgcgcgcgtcgaagcactcatcgccggctgggggatggacgaggcgctgcgt
cgcgcggaagcctatcgccaggcaggcgccgacgcgatcctgattcacagcaagctctcg
cgtcccgacgaaattctcgagttcgcacgcgaatgggccggccgcgggccgctcgtcatc
gtgccgaccaagtactacagcacgcccacggaagtgttccgcgaagccggcatcagcacg
gtcatctgggcgaatcatctgatccgcgccgcgacctcggccatgcaggccgtggccaag
gacattcattcgagcgaaacgctcgtcaacgtcgaagacagcatcgccgccgtcaacgaa
attttccgtctgcaggacgccgacgaatattcggaagccgaagaccgttatctgtcgagc
ggacgcgcggccggtgcggcgatcgtgctcgcggcaagccgcggcaaggggctcgaagcc
gtcactgaagatcgtccgaaagtcatgctgccgatcgcgggcaagccgctgttgcgctgg
ctcatcgatgcgttcaagaagcagagtgtcaatgacatcaccgtggtcggcggttatcgc
gccgacgcgatcgatacggccggcatcaagctggtcgtcaacgaacgtcacgcgcaaacc
ggcgaactggcgtcgcttgcctgcgcggtccgcggcgaggtcgacaagctcgcgggcgat
acggtcatctcgtacggcgatctgctgttccgcagctacatcctgcgcgatctggtcgag
agcgaagccaccttcagcgtggtggtcgattcgtcgctgaccgatgcggaaaacgccagc
gtgcgcgacttcgcatggtgctcggcagccgacgatcgcgggctgttcggcaacaaggtc
acgttgcgtcacgtgtcgagcggacagggggcctcgtcggccatcgcttcgcaaacgccg
catggccgctgggtcggtctgctgaatgtgcgcggcgaggggcttgagcgtttgcaggcg
gtactcggcaaactgcaggcgcgcccggatttcgattcgctcgatatgcccgcgttgctg
aatgcgttgatcgaagcgggcgaatcgatcgaagtgcaatacgtccacggtcattggcgt
ggcgtgaacgatctggaagacttccgccgcgccggcgatttcgcgcatgcgcaagcgccg
ttcgcggcagcggtcggcaagcagacgaacgcagccagcggagccgcacaatga

DBGET integrated database retrieval system