KEGG   Pomacea canaliculata (golden apple snail): 112557492Help
Entry
112557492         CDS       T05881                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00040  Pentose and glucuronate interconversions
pcan00051  Fructose and mannose metabolism
pcan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    112557492
   00051 Fructose and mannose metabolism
    112557492
Enzymes [BR:pcan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     112557492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 UDPG_MGDP_dh_N TrkA_N Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 112557492
NCBI-ProteinID: XP_025083177
LinkDB All DBs
AA seq 349 aa AA seqDB search
MADTNLTAILYKKDDLRLEDLPVPEPGPGQVQLCMQQVGICGSDVHYWTHGEIGDFVVKA
PMVLGHEASAVVSKLGPGVTSLQVGDRVAIEPGVPCRVCSYCKTGHYNLCLDMKFCATPP
YNGNLARFYVHDADFCFKLPDNVSFEEGAMLEPLSVGVHACNRANVRLGSKVLICGAGPI
GIVNLVTAKARGAAQVVITDIDQKRLDFAKSMGADAIIKVASPDAKAIASQVEEVLGSLA
DVTIECSGAPPSIRTAIYSTRSGGCVVLVGLGPDLVELPVVNAAVREVDIRGIFRYANCY
PTALAMVASGKVNLKPMITHRFTLERSIEAFETAKRGEGVKIMISCSRE
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atggcagacaccaacctgaccgctattctgtacaagaaagacgatttgcgtctggaggac
ttgccagtaccagaaccgggacctggccaggtgcagttatgcatgcaacaagtgggaata
tgcgggtctgatgtgcattattggacacatggagagattggagattttgttgttaaagct
cccatggttcttggtcatgaagccagtgctgttgtgagcaagctgggacccggtgtcaca
tctcttcaagttggtgacagggtagccatagagcctggtgtaccatgccgagtctgcagc
tactgcaaaactgggcattataacttgtgcttggacatgaaattttgtgctacaccaccc
tataatggcaatctagcacgattttatgttcatgatgcagacttctgctttaagcttcca
gacaacgtcagttttgaggaaggagcaatgctagagcctctgtctgttggcgttcacgca
tgtaatcgtgccaatgttcgcttgggtagcaaagtgctgatttgtggagcaggaccgatt
ggaattgtcaatctggttactgccaaagcccgaggagcagctcaggtagtaattacagat
attgatcagaagcgtcttgacttcgcaaagagcatgggtgctgatgccatcatcaaggtg
gcaagtccagacgcgaaagctatagcttcacaagttgaagaagtgctgggaagccttgct
gatgtgaccatagaatgcagtggtgcacctccaagtatacgtacggctatttattcaaca
cgctctggtggctgtgtggtgttggtgggtctgggacctgaccttgtggaactccctgtg
gtaaatgctgcagtcagagaagtcgacattagaggcatcttcagatatgctaactgctac
ccaactgctttggctatggttgcctctggcaaagtgaatttaaaaccaatgataactcat
cgatttaccttggaaagatccatcgaggcctttgaaactgccaaacgtggagagggtgta
aagatcatgatcagctgtagtagagaataa

DBGET integrated database retrieval system