KEGG   Pomacea canaliculata (golden apple snail): 112559472Help
Entry
112559472         CDS       T05881                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: DNA ligase 1-like
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan03030  DNA replication
pcan03410  Base excision repair
pcan03420  Nucleotide excision repair
pcan03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    112559472
   03410 Base excision repair
    112559472
   03420 Nucleotide excision repair
    112559472
   03430 Mismatch repair
    112559472
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pcan03032]
    112559472
   03400 DNA repair and recombination proteins [BR:pcan03400]
    112559472
Enzymes [BR:pcan01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     112559472
    6.5.1.6  DNA ligase (ATP or NAD+)
     112559472
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     112559472
DNA replication proteins [BR:pcan03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   Other elongation factors
    112559472
 Prokaryotic type
   Elongation factors (archaeal)
    Other elongation factors
     112559472
DNA repair and recombination proteins [BR:pcan03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     112559472
   NER (nucleotide excision repair)
    Other NER factors
     112559472
   MMR (mismatch excision repair)
    Other MMR factors
     112559472
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-GeneID: 112559472
NCBI-ProteinID: XP_025086547
LinkDB All DBs
AA seq 741 aa AA seqDB search
MCRTKCGNSKESSTVVPKETSRVPLNDFFAPRKTSGNKHHKDESEKENDKKDPVPSSESN
HCHKTVSPRIPGDVKVDEKTIPDTSYDPSKSKYHPVNDACWKHGECVPYLALAKTFEAIE
ATSARLRMIEILCNFFRSVLCLSPGDLLQCVYLCLNKLAPAYKGVELGVGETVLMKAIAQ
ATGRTVEKLKADVQEKGDLGLVAENSRSNQRMMFAPPKLTVPGVFSKLKEIALMTGNAVM
AKKIEKIKGMFVACRLSEARYLIRSLGGKLRIGLAEQSVLTALGHAAFLTPLCQDFPPKV
LDAGKGMAADVLKKKLEEAAMIIKTTYCELPNYESVISSLLEHGLEELPKHCKLTPGIPL
KPMLAHPTKGVSEVLRRFENMDFSCEYKYDGERAQIHVLEDGQIHVYSRNSEDNTSKYPX
IIKRMPRVLGSEVKSCVIDSEAVAWDPEKKQILPFQILSTRKRKDADEKEIKVQVCIYSF
DLLYLNGESLVSKPFRIRRQLLRDNFQEVEGEFVFAKSMISSNTEEIEDFLEESIKGNCE
GLMVKSLDVDATYEIAKRSHSWLKLKKDYVEGVGDTLDVVVIGGYIGTGKRTGKYGGFLL
ACYDDDNEEFQSICKIGTGFKDEDLDKHSEFFKDHIIPHPRPYYRWDSAVEPDHWFEAVQ
VWEIKAADLSISPTHKAAMGLVDDTKGISLRFPRFIRIRDDKKPEEATSAAQVAEMYRNQ
QQIQNQKSGETKVVEDEEDFY
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaggaccaaatgtggcaacagtaaagagtctagcacagtggttccaaaggagaca
agtcgtgtaccacttaatgacttttttgcaccacgaaagacctctggaaacaaacaccat
aaagatgagagtgaaaaagaaaatgataaaaaggatccggtcccaagttcagagtcaaac
cactgtcataaaactgtgtcacctagaatacctggtgatgtaaaagttgatgaaaaaacc
ataccagataccagctatgatcctagtaaatccaagtaccatccagtgaatgatgcatgc
tggaaacatggagaatgtgtgccatacctcgctttggctaagacatttgaagcaatagag
gcaacttcagcaaggctacggatgatcgaaatcttgtgcaacttcttccgctccgtgctg
tgcttgtcacctggcgacttgctacaatgcgtgtacctgtgtttgaacaagctggcacct
gcctacaaaggggtggagctgggagtcggcgagactgtgcttatgaaagctattgcacag
gctacaggtcgcactgtggagaaactaaaagctgatgttcaagaaaagggggatcttggc
ttagttgctgagaacagccgcagtaaccagaggatgatgtttgctccaccaaagcttaca
gttcctggtgtcttctccaagctgaaagagatagccttgatgacaggaaatgctgttatg
gccaagaagattgagaagatcaaaggaatgtttgtggcatgccgactctcagaagctcga
tacctcattcgatcacttggaggcaaacttcgcattggcttggcagagcagtccgtgttg
acggcgctcggtcatgctgcttttcttacaccactttgtcaagattttccaccaaaagtc
ttggatgcaggaaaagggatggcagcagatgtgctaaagaaaaagctggaagaagcagct
atgatcatcaagactacttactgtgagctgccaaactatgaatctgtcatctcctctttg
ctggaacatggcttagaagagttacccaaacattgcaagttaactccaggtattcctctg
aaacctatgcttgcacatccaaccaaaggtgtcagcgaggtgttgcggaggtttgaaaac
atggacttcagctgcgagtataagtatgatggagagcgggcacagatccatgtcctggag
gatggtcaaatccatgtgtacagtcgcaactctgaggataacacctccaagtacccgnac
atcatcaagcgcatgccccgggtgttgggatcagaagtcaaatcttgcgtcattgactca
gaggctgttgcatgggatccagagaaaaagcaaattctacctttccagatcctgagcaca
cgaaagaggaaggatgctgatgaaaaagagattaaagtacaagtttgcatctattcgttt
gacctcttgtacttaaatggagaatccttggtaagcaagcctttccggatccggcgtcag
ctcctgcgggataatttccaagaagtggaaggggaatttgtctttgcgaaatccatgatc
tcttccaacacggaagagattgaggatttccttgaagagtctataaagggaaactgtgaa
ggattaatggtaaagtcactggatgttgatgccacttatgaaattgctaaaagatctcat
agctggttgaagttgaagaaagactacgtagaaggtgtaggggacactcttgatgtcgtt
gtcattgggggctacataggcactggtaaacgaacaggaaaatatggaggttttctgctg
gcatgttatgatgacgacaatgaagagttccagtctatttgtaagattggaacagggttt
aaggatgaagatcttgacaaacactcggaattcttcaaggatcacattatacctcatccc
agaccatattatcgctgggattctgctgtggagccagaccactggtttgaagctgtgcaa
gtgtgggagattaaagcagcagatctctccatttccccaacacataaagctgccatggga
ttggttgatgatacaaagggaatatctctgagatttccaaggttcataagaatccgggat
gacaaaaaaccagaagaagccacaagtgcagcacaggtggcagagatgtacaggaaccag
caacaaatacaaaatcaaaagtcaggggagacaaaagttgtagaggacgaagaagatttt
tattaa

DBGET integrated database retrieval system