KEGG   Pomacea canaliculata (golden apple snail): 112562911Help
Entry
112562911         CDS       T05881                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial-like isoform X1
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00020  Citrate cycle (TCA cycle)
pcan00190  Oxidative phosphorylation
pcan01100  Metabolic pathways
pcan01200  Carbon metabolism
Module
pcan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pcan_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    112562911
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    112562911
Enzymes [BR:pcan01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     112562911
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Thi4 Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 112562911
NCBI-ProteinID: XP_025092300
LinkDB All DBs
AA seq 667 aa AA seqDB search
MAALASLSSKVAQKYALQSLLGTTPKCLSAKRDFHFRIQGRNTNAKVSSSSSVSRDYPVV
DHTYDAVVVGAGGAGLRAAFGLAQEGFKTACITKLFPTRSHTVAAQGGINAALGNMEEDD
WRYHFYDTVKGSDWLGDQDAIHYMCEEAPKSVIELENYGMPFSRLENGNIYQRAFGGQST
KYGKGGQAHRCCCVADRTGHSLLHTLYGRSLKFDTDYFIEYFALDLIMEDGECCGVIALC
LEDGSIHRFRAKNTIVATGGYGRTFFSCTSAHTCTGDGTAMLNRAGLANEDMEFIQFHPT
GIYGAGCLITEGSRGEGGFLINSEGERFMERYAPNAKDLASRDVVSRSMTIEIREGRGVG
PEKDHVYLQLHHLPPEILKTRLPGISETAMIFSGVDVTREPIPVLPTVHYNMGGIPTNYK
GQVLQYTKEKGDRIVPGLYAAGEAACASVHGANRLGANSLLDLVVFGRACANTIMAENKP
GDTARPIKQNAGEASVANLDRLRHANGSITTADLRLLMQKTMQAHAAVFRDGPTLQAGCK
KMSEVYKGLDNLKLSDRGLIWNSDLVESLELQNLMINAIQAIYAAEARKESRGAHAREDF
PKRIDEYDYSKPLEGQKKLPMEQHWRKHTLSYVDPATGNVTLNYRPVIDGTLNEKDCPQV
KPAIRAY
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atggctgcacttgcttccttgtcatctaaagtggcgcagaagtacgccttacaaagtttg
ttgggcaccacacccaaatgtctttctgcaaaacgagatttccattttcgtattcaggga
agaaatactaacgcaaaagtttcatcttcatcctcagtgtcccgtgactatcctgtggtt
gatcacacctatgatgcagtggtggtcggagccggtggagcaggccttcgagctgcattt
ggtctggctcaggaagggttcaaaactgcctgcattactaaattatttcccacaagatca
cacactgtggcagcacagggagggatcaatgcagccctaggcaatatggaagaagatgac
tggcgctaccatttctatgacactgtaaaaggttcagattggctgggtgaccaagatgcc
atccattacatgtgtgaggaagcacccaagtcagtcattgagcttgagaactatggcatg
ccatttagtcgcctggaaaatggcaatatctaccaacgagcctttggtggacagagcacc
aagtatggtaaaggaggccaagcccatcgctgctgctgtgttgctgaccgcactggtcac
tcccttcttcatactttatatggtcgttcgctgaagtttgacacagactactttattgaa
tactttgcactggatcttatcatggaagatggagagtgttgtggagtgattgctctttgc
ttagaagatggttcaattcaccgtttccgtgccaagaacaccatcgttgccactggtggt
tatggccgtaccttcttctcctgcacttcagcccacacctgtaccggggatgggacagcc
atgttgaaccgtgctggactggcaaatgaagacatggagtttatccagttccaccctacg
ggcatttatggagcaggctgccttatcacagaaggctctcgtggagaaggtggtttcctc
attaactcagagggagagcgtttcatggagcggtatgcacctaatgcaaaggacttggct
tctcgtgatgttgtttctcgctcaatgaccattgagattcgtgaagggagaggtgtaggc
ccagagaaggaccatgtatatctacagctccatcatctgccccctgaaatattaaagact
cgtctgccaggaatctcagagacagcaatgatcttttccggtgtggatgtgacacgcgaa
ccaattccagtgctgcccacagtccactacaacatgggaggtatccccaccaattataag
ggtcaggtcttgcagtacacaaaagaaaaaggagatagaattgtaccagggctttatgca
gcaggggaggcagcctgtgcttcagttcatggagctaatcgtctgggtgccaactctttg
cttgacttggttgtctttggtcgtgcctgtgctaacacaattatggcggagaataagcca
ggtgacactgctagaccaattaagcagaacgctggtgaagcatcagtggctaatctagat
cgtcttcgccatgcaaacggcagcataaccactgctgatctaagactgttaatgcagaag
acaatgcaagcccatgctgcagtgttccgtgatggaccaaccctgcaggcaggatgcaaa
aagatgtctgaggtctacaagggcttggataatctcaagctttcagatcgtggccttatc
tggaattctgacctagtggaaagccttgagctgcagaacttgatgattaatgcgatacaa
gctatctatgcagcagaggcaaggaaagagagtcgtggtgcacatgccagagaagatttc
cctaaacgtattgatgagtatgactacagcaaaccccttgagggtcaaaagaagctgcca
atggaacagcactggcgcaagcacactttgtcttacgtggacccagccaccgggaatgta
accctgaactacagacctgttattgatggcactctgaatgaaaaggattgcccccaggtc
aagccagccattcgtgcatactag

DBGET integrated database retrieval system