KEGG   Pomacea canaliculata (golden apple snail): 112565245Help
Entry
112565245         CDS       T05881                                 

Definition
(RefSeq) hexokinase-1-like isoform X1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00010  Glycolysis / Gluconeogenesis
pcan00051  Fructose and mannose metabolism
pcan00052  Galactose metabolism
pcan00500  Starch and sucrose metabolism
pcan00520  Amino sugar and nucleotide sugar metabolism
pcan01100  Metabolic pathways
pcan01200  Carbon metabolism
Module
pcan_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pcan_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    112565245
   00051 Fructose and mannose metabolism
    112565245
   00052 Galactose metabolism
    112565245
   00500 Starch and sucrose metabolism
    112565245
   00520 Amino sugar and nucleotide sugar metabolism
    112565245
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    112565245
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pcan04131]
    112565245
Enzymes [BR:pcan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     112565245
Membrane trafficking [BR:pcan04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    112565245
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 PGM_PMM_III FGGY_N
Motif
Other DBs
NCBI-GeneID: 112565245
NCBI-ProteinID: XP_025096389
LinkDB All DBs
AA seq 492 aa AA seqDB search
MGARQSTFSSQSTQFKQRRKSLRYIIAEKADAKKVENILKPLELTDDDYRKVVDLMQEKM
EEGLARSTNDKATIKMFPTYVRAVPNGTESGEFLALDLGGTNFRVLLVSLQGQEVKMESK
IFLIPQHIMLGTGVQLFDHIADCIYKFIKEHNVKAQLLPLGFTFSFPCRQNGLASATLTT
WTKGFKCEGVEGNDIVKLLHDAIKRRGDLDVKCLAVINDTVGALMSCAHSDRQCAIGLIL
GTGSNACYIEKLERVEMAEGNEPGPPEMLINTEWGAFGDDGCLDFITTDFDRQVDKHSIN
AGKQRYEKFVSGMYMGEIARLALEKLRKSGLLFGGEGSYHMATRGRFYTKYVSEIEGDDI
DSFKTTKQIFQELEIEKVTEQDCRLVRHTCSLVSRRAAFLASAGLACLLRMMGRPEVTIG
VDGSLYRFHPFFHDLMMEKIRTLAPGIRFKLMLSHDGSGKGAALVAAVASRILKEKEENS
EKTRDHAKSNPH
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgggggcacgtcaaagtacgttttcatcccagagtacacagtttaaacagcgcagaaaa
agcttgcgatacatcatcgcagaaaaagcggacgcaaagaaggttgagaatatcttgaag
ccgctagagcttactgatgatgactaccgaaaagtcgtggaccttatgcaggagaagatg
gaagagggattggcccgaagcacaaatgataaggctaccatcaagatgtttcccacatat
gtgcgtgctgtaccaaatggaacagaatctggcgaattcctggccttggatctgggtgga
accaacttccgtgtcctgcttgtttcactgcaaggtcaggaggtaaagatggagagcaaa
atcttcctgattccacagcacatcatgcttggcacaggtgtacagctgtttgatcatata
gcagactgcatttacaagtttataaaagagcacaacgtgaaagcacaacttctgcctctt
ggctttactttctcttttccctgccggcaaaatggtcttgccagtgctacactcaccaca
tggacaaagggtttcaagtgtgaaggggtggaaggcaatgatattgttaaacttctacat
gatgctatcaaaagacgtggggatttagatgtgaagtgcttggctgttattaatgataca
gtgggagcccttatgtcctgtgcccatagtgaccgacagtgtgcaattggcctcattcta
ggcactggaagcaatgcctgctatatagaaaagctggagcgagtagaaatggctgaagga
aatgagcctgggccaccagagatgttgatcaacacagagtggggagcatttggtgatgat
ggttgtcttgacttcattacaacagattttgatcgacaagttgacaagcattctattaat
gcaggaaagcaaagatacgagaagtttgtatcaggcatgtacatgggcgagattgctcga
ctggctctggagaaattgaggaagagtggcttgctgtttggtggtgagggatcgtaccac
atggccactcgtgggagattttacaccaaatatgtttctgaaattgaaggagatgatata
gacagttttaaaactacaaagcagatctttcaggagcttgagattgaaaaagtgacagag
caggattgtcgtcttgtccgccatacatgcagccttgtgtcccgccgggctgctttcctt
gcatctgctggcctggcttgtttattaaggatgatgggcagacctgaggtgaccattggc
gttgatggctctctctaccgatttcacccattcttccatgatttgatgatggaaaaaata
cgaactctagctcctggcattcgttttaaactgatgctgtctcacgatggaagtggcaaa
ggagcggcattagtggcagctgtggccagtcgcattttgaaagagaaagaagaaaactca
gaaaaaactagagaccatgcaaaatcaaatcctcattaa

DBGET integrated database retrieval system