KEGG   Pomacea canaliculata (golden apple snail): 112566296
Entry
112566296         CDS       T05881                                 

Definition
(RefSeq) cyclin-dependent kinase inhibitor 1-like
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112566296
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 112566296
NCBI-ProteinID: XP_025098158
LinkDB
AA seq 185 aa
MSVASNVRRCLFGPLDSSSRRKSSDLSSRYADRDAQRFKERWNYDVRTDTPLSGPYAWIT
PPSSDIPSVYYKNYNWRCSKRRAQQQGDVDTDDNDDGGSRAALVSQASPVQRGDVNVVLG
VSNASQKQVEDETTPPHRSSKSEYSKKPGRNIQSRLEDYYKIVKRSATPETEPVVCIKKR
RLDSS
NT seq 558 nt   +upstreamnt  +downstreamnt
atgtctgtagcttccaatgtaaggcgctgtctgttcggccctctggacagcagcagtcga
cgaaagtcctcggacttgtcgtcgcgctatgccgatcgggacgcccaacgtttcaaagaa
agatggaattacgatgtgagaacagacacgcctttgagtggtccctacgcttggattaca
ccaccctcatcggacattccatctgtgtactataaaaactacaattggagatgcagcaag
cgacgagcacagcaacagggagacgtggacacagacgataacgacgatggtggtagtcgt
gccgccctggtgtcgcaagctagccctgtgcagcgtggagatgtgaatgtggtgttggga
gtttccaatgcatcccagaaacaggtcgaggacgaaaccacaccaccacatcggagctcc
aaatcggagtacagcaagaagccaggacgaaacatccagagtcggttagaagactattac
aagatagtaaagagaagtgctacacccgaaacagaacctgtggtctgcatcaaaaagagg
cgtctagacagtagttga

DBGET integrated database retrieval system