KEGG   Pomacea canaliculata (golden apple snail): 112567360Help
Entry
112567360         CDS       T05881                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan00480  Glutathione metabolism
pcan00980  Metabolism of xenobiotics by cytochrome P450
pcan00982  Drug metabolism - cytochrome P450
pcan00983  Drug metabolism - other enzymes
pcan01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    112567360
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    112567360
   00982 Drug metabolism - cytochrome P450
    112567360
   00983 Drug metabolism - other enzymes
    112567360
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pcan02000]
    112567360
Enzymes [BR:pcan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     112567360
Transporters [BR:pcan02000]
 Other transporters
  Pores ion channels [TC:1]
   112567360
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N GST_N_2 GST_C_2 GST_C Glutaredoxin GST_C_3 GST_C_5
Motif
Other DBs
NCBI-GeneID: 112567360
NCBI-ProteinID: XP_025099845
LinkDB All DBs
AA seq 240 aa AA seqDB search
MSQKALSTGSSCPPLSPGTLRLYSMRFCPYALRTRLVLAHKQIPFETVNVDLKNKPEWFL
KINPKGLVPTLEKDGKVVYESFITCDYLDDVYPQNRLTPSDPYQRALDAMFLDYFNNKFV
PNFFKVIRSKGKDDEARGELLKALQKINDEISKRGKFFGGDEVRMIDYMMWPWLQRLPLV
CQFDPVFEASSSDLPELSAWSERMQAQPAVQETDINQEIYATFFKQYLEGNPPYDLGLEP
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgtcacaaaaagctttgtccacaggctcctcatgcccacctttgtccccaggaacgctg
cgactctatagtatgcgcttctgcccatatgcattgcgcacacgtcttgtgttggctcac
aaacagatcccgtttgaaaccgtaaatgtggacctgaaaaataagcctgagtggttcctg
aagataaatcccaaaggcctggtaccaacactggagaaagatgggaaagtggtttatgag
tcatttattacctgtgattacctggatgatgtataccctcagaaccggttgactccctct
gatccttaccaaagggcactggatgccatgttcctcgactattttaataacaagtttgta
cccaattttttcaaagtaattcgctcaaaaggaaaagatgatgaagcaaggggtgaacta
ctgaaagcattacagaaaattaatgatgagatttcaaaaagagggaagttctttggaggt
gatgaggtgagaatgattgattacatgatgtggccatggctacaacggctaccacttgtt
tgtcagtttgacccagtctttgaggcatccagcagcgatcttccagaactctctgcttgg
agtgagaggatgcaggctcagcccgctgtgcaagaaacagacattaatcaagagatatat
gccacattctttaagcagtatctggaaggcaatcctccttatgaccttggtcttgagcca
tga

DBGET integrated database retrieval system