KEGG   Pomacea canaliculata (golden apple snail): 112571529Help
Entry
112571529         CDS       T05881                                 

Definition
(RefSeq) deaminated glutathione amidase-like
  KO
K11206  deaminated glutathione amidase [EC:3.5.1.128]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    112571529
Enzymes [BR:pcan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.128  deaminated glutathione amidase
     112571529
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CN_hydrolase HIT DcpS_C MTHFR
Motif
Other DBs
NCBI-GeneID: 112571529
NCBI-ProteinID: XP_025106347
LinkDB All DBs
AA seq 487 aa AA seqDB search
MKLFSASHLFRSGLTVRRRVGVYQKPLSQFTSNMASNSFPLSSEKMNPLVGVCQMTSTAD
KEANFAVCQALIHKAKKLGVQMLFFPEACDYIADSKSQTVEMAESLNGDIMKRYCRAAQE
SGIWLSIGGFHQKGPDSDVKRIHNTHVLIDNEGTIRATYEKAHLFDLDLKGRVRLCESDY
TVPGKKIVPPVMTPIGRVAMSTCYDVRFPELALVLTQQGADILTFPSAFTQATGMAHWEV
LMRARAIENQCYVIAAAQTGRHNEKRVSYGHAMIVDPWGCVVAQCQEGTNVAVAEIDLGY
RARIQQEMPVWQHRRFDLYSPVTALKCDLTYDLDRQPEYQFGHVKISSSCVFSRSALSYA
FVNIKPVVPGHMLVASLRAVERLTDLTHAEVADLFCLAQRVSDVAQKQFKACSVTLAVQD
GIDAGQTIKHVHVHILPRKQDDFKQNDDVYHHLQMHDKDLSNGTPGLRTQEEMAEEAALM
REAFSKY
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttttctccgcttctcacctgtttcgcagcgggttgactgtgaggaggagagtt
ggggtctaccaaaagcctctttcacagttcacgtcaaatatggccagtaatagttttccg
ctatcctcagaaaagatgaaccctttggtcggggtctgtcaaatgacgagtactgctgac
aaagaggcaaactttgcggtctgtcaagctttgatacacaaggcaaaaaagcttggagtt
cagatgttgttcttccctgaagcgtgtgactacattgctgattcaaaatcacagacggta
gaaatggcggagagtttaaatggagacattatgaaacggtactgcagagctgctcaagaa
agtggtatttggctttctataggtggtttccaccaaaagggtcctgacagtgacgtgaaa
cgtattcacaacactcatgttttgattgataatgaaggaactatcagagccacatatgag
aaggcacacttatttgatcttgaccttaaaggtcgagtgaggttgtgtgaaagtgactac
actgtgcctggcaaaaagattgtaccgcctgtcatgactcctattggtcgagtggctatg
tctacttgctatgatgtccgatttcctgaactggcattagtgctgactcagcagggagca
gatattttgactttcccatcagctttcacacaagccacaggaatggcacactgggaggtg
ttaatgcgtgctcgagccattgaaaaccagtgctatgtgatagctgcagctcagactggt
agacacaatgaaaagagggtatcatatggccatgctatgattgtagatccctggggctgt
gtcgtggcacaatgtcaagaaggaacaaatgtggcagtggctgagatcgacctgggttac
agagctcgaatacaacaggaaatgccagtttggcagcatcgacgatttgacttgtattct
ccagtcacagccctaaaatgtgatcttacatatgacttggacaggcaaccagaataccaa
tttggacatgtgaaaataagttcttcttgtgtcttttcccgttctgctctgtcttatgca
tttgtcaacatcaagccagtcgtgcctggccatatgcttgtagcatctttaagagctgta
gaacggctgactgatctgacccatgctgaggttgctgatctcttctgtcttgcacagcgc
gtgtctgatgttgcacaaaaacagttcaaagcctgttcggtcacattggcagtacaagat
ggcatagatgctgggcagactataaagcatgttcatgttcacatccttcccaggaaacaa
gatgactttaaacaaaacgatgatgtgtatcatcacctgcaaatgcacgacaaagatttg
agtaatggtaccccaggactgcgaacacaagaggagatggctgaggaagctgcattgatg
agagaagcattctcaaaatattga

DBGET integrated database retrieval system