KEGG   Pomacea canaliculata (golden apple snail): 112573234Help
Entry
112573234         CDS       T05881                                 

Definition
(RefSeq) cAMP-dependent protein kinase catalytic subunit alpha isoform X1
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan04140  Autophagy - animal
pcan04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    112573234
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112573234
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pcan01001]
    112573234
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:pcan03019]
    112573234
   03036 Chromosome and associated proteins [BR:pcan03036]
    112573234
Enzymes [BR:pcan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     112573234
Protein kinases [BR:pcan01001]
 Serine/threonine kinases: AGC group
  PKA family
   112573234
Messenger RNA biogenesis [BR:pcan03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     112573234
Chromosome and associated proteins [BR:pcan03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    112573234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 112573234
NCBI-ProteinID: XP_025109198
LinkDB All DBs
AA seq 372 aa AA seqDB search
MAEIIQKLFGQKSRQDSSRSSDGEGYTRQQYEFFKEFLAQAKEEFQKKWDHPPPPDNTHC
LDDFDRIKTLGTGSFGRVMLVQHKGGSKEYYAMKILDKQKVVKLKQVEHTLNEKRILQAI
SFPFLVSLEFAFKDNSNLYMVLEFVNGGEMFSHLRRIGRFSEPHSRFYAAQIVLVLEYLH
HLDIMYRDLKPENLLIDSQGYLKVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKA
VDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLT
KRFGNLKNGVNDIKNHKWFSTTDWIAIYQKKVEAPFVPKTRGGGDTCNFDDYEEEPLRIS
STEKCAKEFADF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaatcatacagaaactttttggacagaaaagtaggcaagattcgagtaggagt
tctgacggagaaggctacacgagacaacaatacgaattttttaaagaatttcttgcccaa
gcaaaggaggaatttcaaaagaagtgggatcatccacctccaccagataacacacactgc
ctggatgactttgacagaatcaaaactcttggcacggggtcctttggcagagtcatgttg
gttcaacataaaggtggcagcaaggagtattatgccatgaagatattagacaaacagaaa
gtggtgaagttaaaacaagtggagcatactctaaatgagaagaggattctacaggctata
tcctttccatttctggtcagcctagagtttgcattcaaggacaactccaatctctatatg
gttttagagtttgtcaacggtggagagatgttttcacatttacggaggatagggagattc
agcgagccgcattcccgattttacgctgcacaaattgtcttggtgttggaatacttgcat
cacttggatataatgtaccgagatttaaaacctgagaacttactgatagattcccaaggt
tatctcaaggtgacagattttggttttgccaagcgagtcaagggtcgcacctggacactt
tgtggtacacctgaatacctagcaccggagatcattctgagcaagggttataacaaggca
gtagactggtgggcattgggtgtcctcatctatgaaatggctgctgggtacccaccattt
tttgcagatcagcctatacagatctacgagaagattgtatctggcaaggtgcgtttccct
tcccacttcagctcagacctgaaggacttactgcgcaacttgctgcaggtggacctaacc
aagcgctttggcaatttgaaaaacggtgtgaatgacattaaaaatcacaaatggttctcg
actactgactggattgcaatctatcagaaaaaggtggaagccccatttgtgccaaagaca
agaggtggtggagatacctgcaactttgatgactatgaggaagagcctcttcgcatctct
tccacagagaaatgtgccaaggaatttgcagacttttga

DBGET integrated database retrieval system