KEGG   Pomacea canaliculata (golden apple snail): 112575671
Entry
112575671         CDS       T05881                                 

Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta-like
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
pcan  Pomacea canaliculata (golden apple snail)
Pathway
pcan04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    112575671
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcan03000]
    112575671
Transcription factors [BR:pcan03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    112575671
SSDB
Motif
Pfam: bZIP_1 bZIP_2 ZapB DivIC DUF2205 DUF4047 Seadorna_VP6 YabA
Other DBs
NCBI-GeneID: 112575671
NCBI-ProteinID: XP_025113432
LinkDB
AA seq 771 aa
MAKDCVSEVDRKFLANHFLADEDWDAGVSDNTDLAHVFNQTLAFDPNALPDELADFDPVK
FDTFDFDELLQEQSHSDSSDSGIIIKQEPPSPASSQISEGSSEGYSSCSDLLLQAVIKEE
SVSPLDSPSFSYSNDSGFILSPPLSPPSLSSFSTSAASLSPPGSPSLPGDQTLIFIPQVD
GDSVSEQLVLPSDVSPFPGSILTSSTGTSLSSPTSVVLTAPTVTLGSSIKQANVHSILNR
KIKIQPKPTVTSGSVTTKPSANHVLSPRTANAVTSVPISSAVAAEDVVCQVVPKVEVRTM
SVKSAGGGRPLVVSAEQFQKLTESGVLRWSPPLSDSSFVTSLSPTSSTSSAYAPQGQICD
LTKSKRQQRMIKNRESASLSRKRKKEYLVSLEQQVKEFNFENQKLKNENEALKQHIHVLQ
SENSQLRQASGLSPAKKACLLAVALLLSLNLAPFSSFFKEIDTTNVRNTISTSRINSRHL
LSLPENTTTTDTSDDAYTGPSTRLFGTSDRMQHVLEFDRELHHLLSKGMLNESTMAAHFC
PIYFNSTESSRLAEQLRGWMIREEEEKQRKVSTRQPQQQQQVPSKKRVKAYPPINTLKAA
MQGHYTKDVEGHQHRPRQTLLSAIPRRNDTFYVLSFNTDYFLVPATAHNKTARPRMSLVM
PFLSGTLNDSMQPPEGSIGMMQINCEIFDTQLIHVHKSVLPPEFNKNAHNFANQTHNSEP
PSSNRSKTGASDARKEASHSPPQTSGEHIKLESRTGNGTVFPPLQRKKRRK
NT seq 2316 nt   +upstreamnt  +downstreamnt
atggcaaaagactgcgtatcagaagttgacagaaagttccttgctaatcattttctcgca
gatgaagactgggatgctggggtatcagacaacacagacctggcacacgtttttaaccag
accttagcttttgatcctaatgctttgccagatgagttggcagactttgaccccgtgaag
ttcgacacatttgattttgatgagcttttgcaagagcagagtcacagcgacagttcagac
agtggtatcatcataaagcaagaaccaccatcacctgcttcatcacaaatatcagaaggc
agctctgaaggatacagttcctgctccgacttactgctacaggcagtgatcaaagaggag
tctgtctcacccttggattcaccatctttctcgtattccaatgattctgggtttatactg
tcgcctccactctcaccaccaagtctgagcagcttttccacatctgctgcatcactctca
ccacctggctctccatctttgcctggcgatcagactttgatcttcattccacaagtggat
ggggactcagtctccgagcagttggtcctcccttcagatgtttctccattccctggttct
atcctcacctcatcaacagggacttctttgtcgtctccaacatctgtggtgttgacagct
cctactgtgaccctaggttcatcaatcaagcaagccaatgtccactcaattctcaatcga
aagatcaagatccaaccaaaaccaacggtgacatcaggctctgttacaacaaaaccatct
gccaaccatgttttatccccaaggactgctaatgcagtcacgtcagtgcccataagttct
gctgtcgctgctgaagacgtagtgtgtcaggtggtgccaaaggtagaagtcagaaccatg
tcagtgaaatcagcagggggaggcaggcctctggtggtgagtgcagaacagtttcaaaag
ttgacagagtcgggagttctgcgatggtctcctcccttatcagactcgagctttgtaacg
tcactgtctcctacatcttcaacctcatcagcatatgcgccacagggtcagatttgtgac
ttgacgaagtcaaagcggcagcagaggatgataaagaacagagagtcagcaagcctgtca
aggaaacgaaagaaagagtacctggtatcgctagagcagcaagtgaaggagtttaacttt
gagaatcagaaattgaagaatgagaatgaggctctcaaacagcacattcacgtgctgcag
tcagagaatagtcagctgcgccaagcctcaggactgtcaccggctaagaaggcctgtttg
ctggcagtggccttgttgttgtctcttaaccttgcacctttcagttcatttttcaaggag
atagatacaacaaatgtacgaaatacaatctccacgtcccgaatcaacagtcgacactta
ctgtccttaccggaaaatacaaccaccacagacacctctgatgatgcatacacaggccca
agcactcgtttgtttggcacaagtgaccgcatgcagcatgtgctggagtttgaccgagag
ctgcaccatctcctctcaaaggggatgctaaacgaatcaaccatggcggcccatttttgt
cccatttacttcaatagcactgaatcttcaagactggctgagcagctgcgtggctggatg
atccgtgaggaggaggaaaagcagagaaaggtcagcacaaggcaaccacaacagcagcag
caggtgcccagcaaaaagagggtcaaggcctacccgcccatcaacaccttgaaagcagcc
atgcagggccactacaccaaagacgtggagggccatcagcacagacccagacagacattg
ctaagcgctatcccacgacgtaatgacacattttatgtgctttcgtttaatacggactac
ttcctagtccccgccactgctcataacaagactgcacgaccacgaatgtctcttgtcatg
cctttcttaagtggaaccctcaatgattccatgcagcccccagagggaagcattggtatg
atgcagatcaactgtgaaatattcgatacccagctgattcatgttcacaagtctgtcctc
ccacctgagtttaacaaaaatgcacataactttgccaatcagactcacaacagtgaacct
ccatcctccaataggagtaaaacaggagcatcagatgctagaaaagaggcttcccattca
ccccctcagacatctggagaacacataaagttagaatccaggactggtaatgggactgtg
tttcctccactgcaaaggaaaaagcgaagaaagtag

DBGET integrated database retrieval system