KEGG   Pomacea canaliculata (golden apple snail): 112576578Help
Entry
112576578         CDS       T05881                                 

Definition
(RefSeq) transcriptional regulator ERG-like isoform X1
  KO
K09435  transcriptional regulator ERG
Organism
pcan  Pomacea canaliculata (golden apple snail)
Brite
KEGG Orthology (KO) [BR:pcan00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pcan03000]
    112576578
Transcription factors [BR:pcan03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    112576578
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets SAM_PNT SAM_3 BAALC_N TFIIA
Motif
Other DBs
NCBI-GeneID: 112576578
NCBI-ProteinID: XP_025114923
LinkDB All DBs
AA seq 741 aa AA seqDB search
MLQYTDVRRKKSGIMLSDPHADDSVFSSPQTCQPNDTDDLDVKRRLQEEIPSFFGTASDG
ERGEDTREAEEPAGIGRQPVLDGNGELDGTEELTEPGSDAEDVEREVTQQHWSSFENGVG
TGMSMVDINAMKVCTCSGFEIPTQASPLYSAQLQQQQQPQRPDIQQLQQQQQQLLNQQQS
QQFCFPNMSDAPTSTSSVVRSPPLDPMLTQSQEMTDSDGLPPYEPSTYIYNTSSHYSSNP
SLPSTLSPYAGVSAKGVHPSSNLGTTDVLGGLGSLRNRHGRPTMEQTGGDLGLDRTVGDS
AASGSRTTADVFGRLSASIPSMGGQGVDQDPVGENLEKEPVTVPLDVESWTREHVRQWLE
WTAREYQLQDVDVSKFQHVDGRRLCAMSREDLVRLVNTHNASVLLQYLAYLRRKHEDCMK
SANSRLSGGPISSTNNFLIGTEQQLHQQQQPPHHQQQQRQSPHMLHSSPTSTTHYRGHIG
ATAVSYPSHAGSPAYCMPKPEPPTFSGKPAWNPQQAGAQGSCYSQTFAAVPKPAFDPSPS
WRPQVNPYDVLAPITSRLSATGSGQIQLWQFLLELLSDSANAGCITWEGTNGEFKLVDPD
EVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFVGLTQVLQSSGDS
SAFKRDFQQDLFSYSAHKYPHHPHGLPPPHSHHMGSPPSTLFTPHSSYWPSHNNNFLPGI
SASMMTPSSHLGSPLSYHPYG
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgcttcagtacacggacgtgaggcgcaagaagtccggaataatgctttccgaccctcac
gcagacgacagcgtcttctcaagtccacagacgtgtcagcccaacgacaccgacgacctc
gacgtcaagcgccgcctgcaggaagaaataccgtctttctttggcacggcgagcgatggc
gagcgtggagaagataccagggaggccgaagaacctgcaggtatcgggagacaaccagtc
cttgacggcaatggagagctggatgggacagaggaactaaccgaacctggcagtgacgcc
gaggatgtcgaaagggaggtaacgcagcagcactggtcgtccttcgagaacggagttgga
actgggatgagcatggtggacattaatgccatgaaagtgtgcacctgcagtggtttcgag
atccccacccaagcctcaccactctacagcgcccagctacagcagcaacaacagccccaa
cgtccagacatccaacagctgcagcagcaacagcagcagcttcttaaccagcaacaatcg
caacagttttgttttccaaacatgagcgacgctcctacctccacttcttccgtggtcagg
tctcctccactggatcccatgttgacgcaatcccaggaaatgaccgattcggatggcctt
cctccatacgaaccttccacttacatctacaacaccagcagtcattactcctccaaccca
tcgctgccttctaccctttctccatacgcaggtgtctcggctaaaggagtccaccccagc
tctaatctggggactacggatgtccttgggggacttggatccctgagaaacagacatggc
cgtcccacgatggagcagacaggcggtgatttgggcttagacaggactgttggcgattcc
gcggcttccgggtcacggacgacagctgacgtgtttggtcgcctgtcggcatccataccc
tcgatgggaggacagggtgtagatcaagatccggtgggagaaaatctggagaaggaacca
gtgactgtacctttagacgtagagtcatggacgcgagagcacgtgcgtcagtggctggag
tggacggcgcgcgaataccaactgcaggatgttgacgtcagcaagttccagcacgtggac
ggccggcgtctgtgcgccatgagtcgcgaggaccttgtgcgcctcgtcaacacacacaac
gccagtgtcctgttgcagtacctcgcctacctgcgccgcaagcatgaagactgcatgaaa
agcgccaactctcgtctaagtggcggtccgatcagcagcacaaacaatttcctgattggc
acagaacaacaactccaccagcagcaacaaccaccccatcatcaacagcagcaacgtcaa
agcccacacatgcttcattcgtcgccaaccagcaccactcactacaggggccatattggt
gccactgctgtctcttaccccagccacgctgggtctccggcctactgcatgccgaagcca
gaaccccctaccttcagcggtaagccagcgtggaacccacagcaggcaggcgcgcaaggg
tcgtgctactcacaaaccttcgcagcagtgcccaagcctgcattcgatccgtcgccgtct
tggagaccccaagttaacccgtacgatgttttggcccctattaccagccgtctgtcagcg
acaggctcgggccagatccagttgtggcagttcctgctggagttgttgtccgactcggcc
aacgcaggctgcatcacgtgggaggggaccaacggcgagttcaagctggtcgacccggac
gaagtggcgcggcgctggggcgagcgcaaatccaagcccaacatgaactacgacaagctc
agccgcgcgctgcgctactactacgacaagaacatcatgaccaaggtacacggcaagcgc
tacgcctacaagttcgacttcgtcggcctgacgcaggtgctgcagtcgtctggcgactct
tcggccttcaagagggatttccagcaggaccttttctcctactcggctcacaagtaccca
catcacccgcacggcctgcccccgccccacagccaccacatgggttcacctccttccact
ctattcaccccgcacagctcctactggcccagccacaacaataactttctacccgggatt
tcggcatccatgatgacgccaagttcacatctgggatcccctctctcctaccacccatat
ggatga

DBGET integrated database retrieval system