KEGG   Pseudoalteromonas carrageenovora: PC2016_3485Help
Entry
PC2016_3485       CDS       T06565                                 

Definition
(GenBank) Alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pcar  Pseudoalteromonas carrageenovora
Brite
KEGG Orthology (KO) [BR:pcar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PC2016_3485
Enzymes [BR:pcar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PC2016_3485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO NAD_binding_9 FAD_oxidored Thi4 FAD_binding_3 K_oxygenase Glutaredoxin NAD_binding_8 FMO-like
Motif
Other DBs
NCBI-ProteinID: QBJ73660
LinkDB All DBs
Position
II:complement(358396..359979)
Genome map
AA seq 527 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSAEVESLANDLASLSDKFTVVNNPDTSA
RRPSMVVHSPVKNTHITFAGVPMGHEFTSLVLALLHTGGHASKAKSEDIEQIQSLDQELI
FEIYISLSCQTCPQVVQALNTMAATNSKIKATMIDGALFQEEVEERNILAVPAVYLNGEP
FSQGALSLTDILNKVDSKGAARQAAALSEKDEFDVLVVGGGPAGASASIYSARKGLNTGI
VAERFGGQVADTLAIENFISVKATEGPKLVAQLEEHVKEYDVDVMHNQRAAGLERVNNKY
EITLENGATLKAKSLVLATGARWREMNVPGEQEYRGHGVAYCPHCDGPLFKGKPVAVIGG
GNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKANSLNNITIIKNAQTTEVLGDGKK
VTGLTYTDRVTGDSKALTLAGIFVQIGLIPNTEWLKISDLELSKFGEILIDAKGATSLPG
VYGAGDATNIPFKQIIIAMGSGATASLGAFDYLIRNSEESEQDKTAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacaacattaaaaatcaattaaaaagccattttgaatcgcttactcaacct
gttgagctgcttattgccttggatgacagcaaaaaatcagcagaagtagaaagcttagca
aacgacttagcatcattaagcgataagtttacggtagttaacaacccagataccagcgca
cgacgcccgtctatggttgtacattcaccggttaaaaatacccacattacgtttgcaggc
gtaccgatgggacacgaatttacaagtttagtgttggcgcttttacatactggcggacat
gcaagtaaagcaaaaagcgaagacattgaacaaatacaatcacttgatcaagaacttatt
tttgaaatttacattagcttgagttgccaaacgtgcccacaagtagtgcaggcgctaaat
acaatggccgcgactaatagcaaaattaaagcaacaatgattgacggcgcactatttcaa
gaggaagtagaagagcgcaacattttagcagtaccggctgtttatttaaatggcgaacca
tttagccaaggtgcattaagcctaactgacatattaaacaaagtagatagtaaaggtgca
gcacgccaagctgcagcacttagcgaaaaagacgaatttgacgtattagtagtaggtggc
ggacctgccggtgcatcagcttcaatttattctgcacgtaaagggttaaataccggcatt
gttgcagagcgatttggtgggcaagttgctgatacattagccattgaaaactttatatcg
gttaaagccactgaaggtcctaagcttgttgcacagcttgaagagcatgtgaaagagtac
gatgttgatgtaatgcataaccaacgtgctgcagggcttgaacgcgtaaataacaaatac
gaaattacgcttgaaaacggggctactttaaaagctaaatcacttgttttagcaacaggt
gcacgctggcgcgaaatgaacgtacccggtgagcaagagtaccgcggacacggtgtcgca
tactgcccgcattgtgacggccctttatttaaaggtaagcctgtagctgtaattggtggt
ggtaactctggtattgaagctgcaatcgatttagcaaacattgttgagcatgtaacagta
cttgagtttgcagatacattacgcgccgatgaagtacttattcgtaaagcaaacagctta
aataatattactattattaaaaacgcccaaactacagaagtacttggcgatggtaaaaag
gttacagggcttacttacacagaccgagtaacaggtgatagtaaggcacttactttagcg
ggtatttttgttcaaataggcttaattcctaacactgagtggttaaaaattagtgacttg
gagttaagtaaatttggtgaaatattaattgatgcaaaaggtgctacgtcattaccaggt
gtttatggcgcaggtgatgcaacaaatatcccatttaagcaaattattattgccatgggc
agcggcgcaacagcgagcctaggtgcttttgattacttaattcgcaacagcgaagaaagc
gagcaagacaaaacagctgcttaa

DBGET integrated database retrieval system