KEGG   Pseudoalteromonas carrageenovora: PC2016_3893
Entry
PC2016_3893       CDS       T06565                                 

Definition
(GenBank) hypothetical protein
  KO
K20850  iota-carrageenase [EC:3.2.1.157]
Organism
pcar  Pseudoalteromonas carrageenovora
Brite
KEGG Orthology (KO) [BR:pcar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PC2016_3893
Enzymes [BR:pcar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.157  iota-carrageenase
     PC2016_3893
SSDB
Other DBs
NCBI-ProteinID: QBJ74059
LinkDB
Position
pKCTC22325:18772..20406
AA seq 544 aa
MLTHRNKALLYTCLLGGTISSAYAASIGNKPGYFTNTISNTVEATITNTGQCSTTNSASA
PGQCTNKIVNALNAASVVSGVVVIKKGTYTLNKISMPSNVRLEIEPDTILKMNQNILFDF
GKKGGNADKAENIEITTTGPKINATKNDRFIIDVNTNTVFQDKRMVRVGYAENFSISRMH
QKDNFSQTPNIFLVADDNGQPGVQSDSGGTNLNRNVVFNSSYSRIPKKGYLADISGEKIA
TGYAVIQPFSGEDLYFKNITGERGITVRIEPGSGLVTDRLNRAGPRHGAYRNIVLDSISN
TGGFAAIFLKPHAKINENIKIKGITKGKNSTFVIWADSGSAPVWADTNDIGYTRGYFTDT
TISGTVKHIITDVNFKSDITIAGSYFLPRKGIRNTASNTSNGNFQIFKLPRDGSGARWLG
QPIAPVAIVSSYSQDNVGNDLVKRHDRPSLTVNGNIEAPSQASSQDLDEGSNNIQRKRYR
KFGGRYSIKVNAAIQADADIDYSLLGLNAGDVTRNNPIIYRENAIDGTNRNGGSITSASE
FISK
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgttaacacacagaaataaagctttgctttacacatgcttattgggcgggacgattagt
tcagcttatgcggcctcaattggaaacaaaccagggtatttcaccaatacaatttctaat
accgttgaagcgacaatcactaacacagggcaatgcagtactactaatagtgcatcggct
cctggtcaatgtactaataagattgtaaatgcactcaatgctgcttcagtagtaagtggt
gtagtagtcatcaaaaaaggcacgtacacattaaataaaatttcgatgccctctaatgtg
cgacttgaaatagagccagatactattttaaaaatgaatcaaaatattttatttgatttt
ggtaaaaaaggcggtaatgcagacaaagcagaaaatattgaaataacaacaacgggtcca
aaaattaatgccacaaagaatgatcgttttattattgatgtaaacacaaatacagttttt
caagataaacgcatggtacgagtagggtatgctgaaaacttttctatttcacgtatgcac
caaaaggataatttttcacaaacacccaatatatttttagtcgcagacgataatggccaa
ccaggtgttcaatctgactctggaggtactaatttaaatcgcaatgtagtatttaactca
agctattctcgcatacctaaaaaaggttatttagccgacatcagtggagaaaaaatagca
acagggtatgccgttattcaaccttttagtggtgaagatttatactttaaaaacattact
ggtgaacgtggtattactgtacgtatagagcccggcagcgggcttgtaacagatagatta
aaccgcgcaggcccacgccacggcgcctacagaaatatagtacttgatagtattagtaac
actggtggttttgccgcaatatttttaaaaccgcatgcaaaaataaacgaaaacataaaa
attaaaggcatcacaaagggtaaaaacagtacttttgtaatctgggctgactcgggtagt
gcgccagtgtgggctgatacaaatgatataggatatacaagaggctattttactgatacc
accatcagcggtacggttaagcacattattaccgatgttaactttaagtcagatattacc
atcgcaggcagttattttttaccaagaaaaggtattcgtaatacggcgtcaaatacgtct
aatgggaattttcaaatatttaagttaccgcgagatgggtctggtgcgcgttggttaggc
caaccgatagcgcctgttgccattgtatcgtcatattctcaagacaatgttggtaacgac
ttagttaaacgtcatgatcgcccgtcgcttactgtaaacggtaatatagaagcacctagc
caagcttcttcacaggacttagatgagggaagtaacaatattcaaagaaaacgatataga
aaatttggtggccgatacagcattaaagttaatgctgctatacaagcggatgcggatatt
gactactcactactaggactgaatgctggggatgtaacgcgcaacaatccaattatttat
cgagaaaatgctattgacggaacaaatcgtaatggtggcagcattacaagcgctagtgaa
tttatcagtaaataa

DBGET integrated database retrieval system