KEGG   Plasmodium chabaudi: PCHAS_040570Help
Entry
PCHAS_040570      CDS       T01108                                 

Gene name
PC000574.03.0
Definition
(RefSeq) FAD-dependent glycerol-3-phosphate dehydrogenase, putative
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
pcb  Plasmodium chabaudi
Pathway
pcb00564  Glycerophospholipid metabolism
pcb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    PCHAS_040570 (PC000574.03.0)
Enzymes [BR:pcb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     PCHAS_040570 (PC000574.03.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 Pyr_redox_2 NAD_binding_8 Reovirus_L2 HI0933_like 3HCDH_N GIDA GMC_oxred_N
Motif
Other DBs
NCBI-GeneID: 3499399
NCBI-ProteinID: XP_016653271
UniProt: A0A077TM21
LinkDB All DBs
Position
4
AA seq 626 aa AA seqDB search
MLKKVLVGGGGLGMISVGGVYLLKVNFHKNMIDKDVTYKYSPIPSRSEMVNRLKSNQYDI
LIIGGGATGAGLALDCATRGIKCALIDRNDFSSGTSSKSTKLLHGGIRYLENAVKKLDIS
ELYFVWEALGERAHAMKIAPFMSRPVPILMPIYKLWQVPYFAYNIKIYDLLADLVCYFDK
GVPNSMYIQKQNTLDQFPLLHQDELKGSLVYYDGQHNDTRMNLNLVLTSAIDDYVPGQVG
ATVCNHMEVISFIMDENNQKIIGVRALDKMNNKEIEIYAKVIINATGPQGDIIRKMADEN
SRPIIQVSVGCHFILPKWYSSKNNGMIIPKTSDGRVLFLLPWENSTIVGTTDEQRPLVDH
PKIDPKDTEFLATELSKYINVSPEEIKNDIKAAWCGFRPLVYDSKKQKKNNNNENSDEVT
THEISRSHEIIEDDNGLISILGGKWTIYRKMAQDTIDYVISKHSDKIQNKNECRTKFLML
IGSHDENGNLNQEDLTFGCSKLGKKLVDKYSEIDYETANYLVSNYGYLSEKVCEIANELK
LFNKLDQSKPYIEAEIVYASRYEFANTISDVIGRRFRLGFIDSNAANQVINKVANLMKDE
LNWSKDQMNKNIEEAKSYIDSLSLQQ
NT seq 1881 nt NT seq  +upstreamnt  +downstreamnt
atgctgaagaaggttctggtcggagggggtggtctcggcatgatatccgttggaggtgtt
taccttctcaaggtaaactttcacaagaacatgattgataaggatgtgacatataagtat
agtccaattcctagtagatctgaaatggtaaacagattaaaatcaaatcaatatgatata
ttaataataggtggtggagcaacaggagcaggattagctttagattgtgcaacaagaggt
ataaaatgtgctctaattgatagaaacgatttttcaagtggaacatcttcaaagtcgact
aaattattacatggtggtattagatatttagaaaatgcagtaaagaaattagatatatcc
gaattatattttgtttgggaagctttaggtgaaagagctcatgcaatgaagattgcaccg
tttatgtctcgacctgttccaatattaatgcctatatataaattatggcaagttccatat
tttgcatataatataaaaatatatgatttattagctgatttagtttgttattttgataaa
ggtgtacctaattcgatgtatatacaaaaacaaaatacgttggatcaattccctttgcta
catcaagatgaattaaaaggttctttggtatactatgatggacaacataacgacacaaga
atgaatttaaatttagtattaacaagtgcaatagatgattatgtaccgggtcaagtcgga
gctactgtatgcaatcatatggaagttataagtttcataatggatgaaaataatcaaaaa
ataataggtgttagagcattagataaaatgaataacaaagaaattgaaatatatgcaaaa
gttattattaatgctacaggaccacaaggagatattattcgaaaaatggctgatgaaaat
agtagacctataatacaagtatcagtaggttgccattttattttacccaaatggtattca
tctaaaaataacggtatgattattcctaagactagtgatggtagagtattatttctttta
ccttgggaaaatagtaccatcgttggaacaactgatgagcaacgtccattagtagatcat
ccaaagattgatcccaaagataccgaatttttagcaactgaattatctaaatatattaat
gtttctcctgaagaaataaaaaatgatattaaagctgcttggtgtggattccgaccttta
gtttatgattcaaaaaaacaaaaaaaaaataataacaatgagaattcagatgaagttaca
acacatgaaatatcgagaagccatgaaattatcgaagatgataatggattaatcagtata
ttaggagggaaatggactatatatagaaagatggctcaagatactatagactatgttata
tcaaaacatagtgataaaatacaaaataaaaatgaatgcagaaccaaatttttaatgtta
attggtagtcatgatgaaaatggaaatttaaatcaagaagatttaacatttggatgtagt
aaattaggaaaaaaacttgttgataaatattctgaaattgattatgaaactgcaaactat
ttagtatcaaattatggatatttatctgaaaaggtttgtgaaatagctaatgaattaaaa
ttatttaataaacttgatcaatcaaaaccatatatagaagctgaaattgtatatgcaagt
agatatgaatttgccaatactatttctgatgtcattggaagaagatttagattaggtttt
attgatagcaatgctgcaaatcaagtaataaacaaagttgctaatttaatgaaagacgaa
ttaaactggtctaaagatcaaatgaataaaaatatcgaagaagcaaaatcttacatcgac
tcattatctttacaacaataa

DBGET integrated database retrieval system