KEGG   Plasmodium chabaudi: PCHAS_050510Help
Entry
PCHAS_050510      CDS       T01108                                 

Gene name
PC401011.00.0
Definition
(RefSeq) dihydrolipoamide acyltransferase, putative
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
pcb  Plasmodium chabaudi
Pathway
pcb00010  Glycolysis / Gluconeogenesis
pcb00020  Citrate cycle (TCA cycle)
pcb00620  Pyruvate metabolism
pcb01100  Metabolic pathways
pcb01110  Biosynthesis of secondary metabolites
pcb01130  Biosynthesis of antibiotics
pcb01200  Carbon metabolism
Module
pcb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:pcb00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PCHAS_050510 (PC401011.00.0)
   00020 Citrate cycle (TCA cycle)
    PCHAS_050510 (PC401011.00.0)
   00620 Pyruvate metabolism
    PCHAS_050510 (PC401011.00.0)
Enzymes [BR:pcb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     PCHAS_050510 (PC401011.00.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-GeneID: 3485370
NCBI-ProteinID: XP_016655154
UniProt: A0A077X9F2
LinkDB All DBs
Position
5
AA seq 606 aa AA seqDB search
MLYMEMIYKKMMRYFIFFLTFWLHTYKCIKTKRNYGFVSFNNLRIPHENKHALYSKVEIK
MPALSSTMTSGKIVRWNKSVGEFVNVGDIIMTVESDKADMDVESFDEGYLRKKIIDEGSE
AGVGDVLGILTTEEGEEVGNDEVGSDQVEKEKITNEQAENEVKVNQIRDDDEKKVYIPLM
QSKKKKARISKWLFKENEFVNKSDVIFHIEDDKSTVEVDSPYTGVIKKILVNEGELADLE
KEVAIISAQEEICELENTPINLKSEIKEHDVISHFKNKLNDTKEGKNFLKTLNYETEKIL
EERLKLSSDKYYQDIHNYFRPSEVDQQNVKGHTQDSQLMKKHKLTPEDITQTKMPDRITY
EDVDLFLEKKNVPKTKDNTRVENKTRIAKLTNIQKSIKNNMMQTLNVPVFRVTHLMKTSQ
LLKIYEQVKDKISMSVILNKCVSLALLKHPLIYSTYIDNENGEIMYNQNINIGNALGLSD
SLLTPVLKNVDQKDIYTLSGEWKELVKKGKNGTLSANEMSGGNFFISNLGMFNTYQFDAI
LPKNVSCILSIGTNIISMDQFEDLKINKGIMMTLTCDHRHIYGSHAATFMNDLANIIENH
ITNIFL
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgttgtatatggaaatgatttataaaaaaatgatgcgatactttattttttttcttacg
ttttggttacatacttataaatgcatcaaaactaaaagaaactatggatttgtaagcttt
aataatttgagaatacctcatgaaaataagcatgctctttactcgaaggttgaaattaaa
atgcctgcgctatctagtaccatgacgagtggcaaaatcgtccggtggaacaaaagcgtt
ggagagtttgtcaacgttggtgacataattatgacagtcgaaagtgataaagcggatatg
gatgtcgaatcgtttgatgaaggatatttaagaaaaaaaataatcgacgaagggtcggaa
gcaggtgttggagacgtactaggaattctaacaacggaggagggcgaagaggtgggaaat
gatgaagtagggagtgatcaagtagaaaaagaaaaaataacgaatgaacaagcggaaaac
gaagtgaaagtaaatcaaataagagatgatgatgaaaaaaaggtgtacattccactaatg
caaagtaaaaaaaagaaagcaagaatttccaaatggttgtttaaagaaaatgagtttgtg
aataaatcggatgtcatatttcacattgaagatgacaaaagtacagtcgaagtggatagt
ccttatacaggtgtaataaaaaaaattttagtgaacgaaggagaactagccgatttggaa
aaagaagttgccatcatttcagctcaagaggaaatatgcgaactggaaaatactcctata
aatttaaaaagcgaaataaaagaacatgatgtaataagccatttcaaaaacaaattaaat
gacactaaagaaggaaaaaactttttaaaaacattgaattatgaaactgaaaaaatactc
gaggaaagactcaaattaagtagtgataaatattatcaagatatccacaactattttagg
ccttctgaagtagatcaacaaaatgtcaaggggcacacacaggacagccaacttatgaag
aagcacaagctaacccccgaagatatcacgcagacgaagatgccagacaggattacctac
gaggatgtcgacctgtttctcgaaaaaaaaaacgttccgaaaacaaaagataacacaaga
gtagaaaacaaaacaagaatagccaaactaacgaatattcaaaagtccataaaaaataat
atgatgcaaacattaaacgttccagtatttcgagtaacacatttaatgaaaacttcgcaa
ttactaaaaatatatgaacaagtcaaagataaaataagcatgtcagtaatattaaataag
tgtgtatcattggctttacttaaacatccattaatctattcaacatatatagataatgaa
aatggagagattatgtacaaccaaaatataaatataggaaatgcgttaggccttagtgat
tccctactaactccagttttaaaaaatgtcgatcaaaaagatatatataccttatcagga
gaatggaaagagcttgtaaaaaaaggaaaaaatggaaccctatcagctaatgaaatgtct
ggaggtaatttttttatttcaaatttaggaatgtttaacacatatcaatttgatgcaatc
ttacccaaaaatgtatcatgtattttatcaattggtacgaatataattagtatggatcaa
tttgaagatttaaaaataaataaaggaataatgatgaccttaacatgtgatcatagacat
atatatggatctcatgctgctacatttatgaatgatctagcaaatattattgaaaatcat
atcacaaatatatttttataa

DBGET integrated database retrieval system