KEGG   Plasmodium chabaudi: PCHAS_051670Help
Entry
PCHAS_051670      CDS       T01108                                 

Gene name
PC302277.00.0
Definition
(RefSeq) leucine-rich repeat protein
  KO
K17550  protein phosphatase 1 regulatory subunit 7
Organism
pcb  Plasmodium chabaudi
Brite
KEGG Orthology (KO) [BR:pcb00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:pcb01009]
    PCHAS_051670 (PC302277.00.0)
Protein phosphatases and associated proteins [BR:pcb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PCHAS_051670 (PC302277.00.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LRR_4 LRR_8 LRR_9 LRR_6
Motif
Other DBs
NCBI-GeneID: 3489515
NCBI-ProteinID: XP_016655220
UniProt: A0A077X909
LinkDB All DBs
Position
5
AA seq 309 aa AA seqDB search
MATYNVLGEIATFDENETIISHQYSRIRKIENIEKCKKLMTLQLISNCIEKIENLENNVE
LEHLELYENSIKRIENISMLINLKVLDLSFNKIKVIENLEALVNLEELYLSSNKISKIEN
LENCKNLRLLELGYNKIRKIENIENLTNLEELWLGKNKIEQLELPELPKLKKLSLQHNRL
TSWNEKSINNVLSLNELYLSYNKLNDINDQIKELKYLKVLDLAYNEIENILICSELKHLE
ELWLNNNNIKSLDMVIKLKNNENLKTLYLEKNEIQDNLKDTYREQIISILPQIQQLDALL
VSPTNMLKK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggctacatataatgtacttggggaaatagctacgtttgatgaaaatgaaacgattatt
tctcatcagtattcgagaattaggaaaatagaaaatattgaaaaatgcaaaaagttaatg
acacttcaattaatttcgaactgcattgaaaaaatcgaaaacttggaaaataatgtagaa
ttggaacacctcgaattatatgagaattctattaaaagaattgaaaacatatcgatgcta
ataaatttaaaagtcctagatctttcatttaacaaaattaaagttattgaaaatttagag
gcactagtaaatttagaagaattatatttgtctagcaataaaatatcaaagattgaaaac
ctggagaactgcaaaaatctgaggctactggaattaggatataataaaatacgtaaaatt
gaaaatatagagaatttgacaaatttagaagagttatggttgggtaagaataaaatagaa
caactcgaattaccagaattaccgaaattaaaaaaattaagtttacaacataacagacta
acgagttggaatgaaaaatctattaataatgttttatcattaaatgagttgtatttaagt
tataacaaattaaatgatataaatgatcaaatcaaagaactaaaatatcttaaagtttta
gatttagcatataatgaaatagaaaatatattaatatgttctgaattaaaacatttagaa
gaattatggttaaataataataatattaaaagtttagatatggttatcaaattaaaaaat
aatgaaaatttaaaaacattatatctagaaaaaaatgaaatacaagataatttaaaagac
acatatagagaacaaattatatcaatcctaccacaaatacagcaattggatgctcttttg
gtatccccaacaaatatgttaaagaaatag

DBGET integrated database retrieval system