KEGG   Plasmodium chabaudi: PCHAS_051830Help
Entry
PCHAS_051830      CDS       T01108                                 

Gene name
PC001322.02.0
Definition
(RefSeq) flavoprotein subunit of succinate dehydrogenase, putative
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
pcb  Plasmodium chabaudi
Pathway
pcb00020  Citrate cycle (TCA cycle)
pcb00190  Oxidative phosphorylation
pcb01100  Metabolic pathways
pcb01110  Biosynthesis of secondary metabolites
pcb01130  Biosynthesis of antibiotics
pcb01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PCHAS_051830 (PC001322.02.0)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PCHAS_051830 (PC001322.02.0)
Enzymes [BR:pcb01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PCHAS_051830 (PC001322.02.0)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 Pyr_redox_2 DAO GIDA Lycopene_cycl FAD_binding_3 HI0933_like NAD_binding_8 Pyr_redox_3
Motif
Other DBs
NCBI-GeneID: 3495455
NCBI-ProteinID: XP_742364
UniProt: A0A077X9Z0
LinkDB All DBs
Position
5
AA seq 631 aa AA seqDB search
MILRGVRNFKFIRTSYCHFSFTKNKAYDIIDHHYDAVIVGAGGAGLRSALELSKNKYKVA
CITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWLGDQNAIQYMCREAPE
SVIELEEFGLPFSRTKDGKIYQRAFGGQSLKYGKGGQAYRCAAAADRTGHAMLHTLYGQS
LSHNCIFFVEYFVLDLLMLNPEECIGVICINIADGKIHRFFSPHTVIATGGYGRAYLSCT
SAHACTGDGNAIVARSKLPLQDLEFVQFHPTGIYPAGCLITEGCRGEGGILRNREGEAFM
MRYAPKAKDLASRDVVSRAMTIEINENRGCGPNADHIYLDLTHLPHETIKERLPGIMETA
KIFAGVDVTKQYIPVLPTVHYNMGGIPTNYKTQVLTQSANFDKCTNNSTDDIIVKGLYAA
GEAASASVHGANRLGANSLLDIVVFGKRAALTIMEIDKPNIPKINPNTNIGEETIQRLDQ
IRFNKGTIQTSNVRKNMQVCMQKHAAVFRIGPLLDKGYKGILDICSQFKDVYISDKTLTW
NTDLLETLELENLLTLSAQTILAAINRKESRGAHARDDFPDRDDKNYLKHSLTWMTNRDV
EKSNFFTTYRSVITKPLDNEMEYVPPVKRVY
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgatcttaagaggggtacgaaacttcaaatttattcgaaccagttattgccatttttcg
ttcactaaaaataaagcatatgatattatagatcaccattatgatgctgtcattgtagga
gcggggggcgcaggtttgagatccgctttagaattatcaaaaaataaatataaagtagca
tgtataactaaattatttccaactcgatcccatacagtagcagcacaaggaggtataaat
gctgccttagggaatatgactgaggatgattggaggtggcatgcttatgatactattaaa
ggatcagattggctaggtgatcaaaatgctattcaatatatgtgtagagaagcccctgaa
tctgttatcgaattagaagaattcggtttgccattttctagaacaaaagatgggaaaata
tatcaaagggcttttggtggccaaagtttaaaatacggtaaaggagggcaagcatataga
tgcgcagctgcggcagatcgaacaggacacgctatgttacacacattgtatgggcaatcg
ttatcacacaattgtattttttttgttgaatattttgtattagatttattaatgttaaat
ccagaggaatgcatcggagttatatgtattaatattgcagatgggaaaatccatcgattt
ttttcaccacacacagttattgcgactggtggatatggtagagcatatttatcttgtact
tctgcacatgcatgtacaggtgatggaaatgctatcgttgccagaagtaaattgccttta
caagatttagaatttgttcaatttcatccaactggtatatatcctgctgggtgtttaatt
acagaaggttgcagaggagaaggggggattttgagaaatagagaaggggaagcatttatg
atgcgatatgcacccaaagctaaagatttagctagtcgagatgtagtaagtagagctatg
acaatagaaataaatgaaaatcgaggatgtggtcccaatgcagatcatatatatctagat
ttaacacatttaccacatgaaacaataaaagaaagattgcctggtattatggaaacagct
aaaatttttgcaggtgtagatgtaacaaagcaatatataccagttttgcctaccgttcat
tataatatggggggtataccaactaattataaaactcaagtattaacacaatctgcaaat
tttgataagtgtacaaataattcgacagatgatataatagttaaaggactttatgctgca
ggtgaagctgcatctgcatccgtacatggagctaatagattaggtgctaattcgttatta
gatattgttgtatttggaaaaagagcagcattaaccattatggaaattgataaaccaaat
attcccaaaattaatcctaatacaaatataggtgaagaaacaatacaaagattagatcaa
ataagatttaataaaggtactattcaaacatctaatgttagaaaaaatatgcaagtatgt
atgcaaaaacatgcagcagtttttcgtataggtcctttattagataaaggatataaagga
atacttgatatttgctcacagtttaaagacgtttatattagtgataaaactttaacgtgg
aatacagatttattagaaacattagagctagaaaatttattaactttatcagctcaaact
atattagctgctattaatcggaaagaatcaagaggagcacatgctcgtgatgatttccct
gatagagatgataaaaattatttgaaacattccttaacatggatgacaaatagggatgta
gaaaaatcaaattttttcacaacatacagaagtgtaattacaaaacctttagacaatgaa
atggagtacgtacctccagttaaaagggtttattaa

DBGET integrated database retrieval system