KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_000820Help
Entry
PCC21_000820      CDS       T02320                                 

Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Brite
Enzymes [BR:pcc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PCC21_000820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFR01485
LinkDB All DBs
Position
complement(95079..95705)
Genome map
AA seq 208 aa AA seqDB search
MSYSLPSLPYAYDALEPHFDKETMEIHHSKHHQAYVNNANAALESLPELAKLSAEELIAQ
LDKVPAEKRTALRNNAGGHVNHSLFWKGLKVGTTLTGDLKAAIERDFGSVDAFKEKFEQA
AATRFGSGWAWLVLKDDGKLAVVSTANQDSPLMGEAVSGASGYPIVGLDVWEHAYYLKYQ
NLRPAYAKAFWNVLNWDEAAARFASAKK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgagttattcactgccatcgctgccttatgcttatgacgcactggaaccgcatttcgac
aaagaaacgatggaaattcaccattccaaacaccatcaggcttacgtcaataatgctaat
gccgcgttggaatctctgcctgaactggctaaattgtctgctgaagagctgatcgctcaa
ctggataaagttcctgcagaaaaaagaacggcactgcgtaacaacgcaggtggccacgtt
aaccacagcctgttctggaaaggcctgaaagtcggcacgacgctgactggcgatctgaaa
gccgccatcgagcgtgatttcggtagcgttgacgcgtttaaagagaaatttgagcaagca
gcagcaacccgcttcggttctggctgggcgtggctggtactgaaagacgacggtaaactg
gccgttgtgtctactgcaaaccaagacagcccgctgatgggtgaagccgtttctggtgcg
tctggctacccaatcgtcggtctggacgtatgggaacacgcttactacctgaaatatcag
aaccttcgcccagcttatgctaaagcattctggaacgtgttgaactgggacgaagccgct
gcccgtttcgctagcgcaaaaaaataa

DBGET integrated database retrieval system