KEGG   Pectobacterium carotovorum subsp. carotovorum PCC21: PCC21_001730Help
Entry
PCC21_001730      CDS       T02320                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase 2, LaPEPC2 (ISS)
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
pcc  Pectobacterium carotovorum subsp. carotovorum PCC21
Pathway
pcc00620  Pyruvate metabolism
pcc00680  Methane metabolism
pcc01100  Metabolic pathways
pcc01120  Microbial metabolism in diverse environments
pcc01200  Carbon metabolism
Module
pcc_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:pcc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    PCC21_001730
  09102 Energy metabolism
   00680 Methane metabolism
    PCC21_001730
Enzymes [BR:pcc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     PCC21_001730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AFR01576
UniProt: J7KM34
LinkDB All DBs
Position
complement(186980..189619)
Genome map
AA seq 879 aa AA seqDB search
MNEQYSAMRSNVSMLGKLLGDTIKEALGENILDKVETIRKLSKSSRAGNEKHRQELLTTL
QNLSNDELLPVARAFSQFLNLTNTAEQYHTISPHGEAASNPALLSNAFERLKESKNLTER
DIRDAVESLSIELVLTAHPTEITRRTLIHKLVEVNTCLKQLDHNDLADYERNQIMRRLRQ
LIAQSWHTDEIRKIRPTPVDEAKWGFAVVENSLWEGVPAFLRELDEQLEQAFGYRLPVDA
VPVRFTSWMGGDRDGNPNVTAEVTRHVLLLSRWKAADLFLRDIQVLVSELSMSECTPELL
ELAGGSEVQEPYRAIMKSLRSQLSSTLSYLEARLTGEERLPPKDLLVTNEQLWEPLHACY
QSLKTCGMGIIADGRLLDTLRRVRCFGVPLVRIDVRQESTRHTEALAEITRYLGLGDYES
WSESDKQAFLIRELSSKRPLLPRYWEPSADTKEVLDTCRVIAKAPIGSVAAYVISMARTP
SDVLAVHLLLKEAGCPFALPVAPLFETLDDLNNADDVMKQLLSIDWYRGFIQGKQMVMIG
YSDSAKDAGVMAASWAQYRAQDALIKTCEKAGIALTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTISSLALYTGAILEANLLPPPEPKQEWHEVMDEL
SRVSCDMYRGYVRENPDFVPYFRAATPELELGKLPLGSRPAKRRPNGGVESLRAIPWIFA
WTQNRLMLPAWLGAGAALQKVVDDGKQEQLEAMCRDWPFFSTRIGMLEMVFAKADLWLAE
YYDQRLVEEKLWPLGKQLRDQLAADINVVLAISNDDHLMADLPWIAESIALRNVYTDPLN
VLQAELLHRSRQQEKPDADLELALMVTIAGVAAGMRNTG
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcaatgcgcagtaacgtcagtatgctcggcaagcttctcggc
gataccatcaaggaagcgctgggtgaaaacatccttgataaagtcgaaacaatccgcaag
ctgtcaaagtcttcccgcgcaggtaatgaaaaacatcgtcaggagctgctgaccacgctg
caaaacctgtctaacgatgaactgttgcccgttgcccgtgcattcagccagttccttaac
ctgaccaataccgccgagcaataccatacgatttcaccgcacggtgaagcggcgagtaac
ccggcactgctttccaacgcctttgagcgtctgaaggaaagcaaaaatctgaccgaacgc
gatatccgtgacgccgtggagtccttgtcgatcgagctggtgctgaccgcgcacccgacc
gaaattacccgtcggacgctgatccacaaactggtggaagtgaatacctgcctcaagcag
ctcgaccataacgatctggctgattatgaacgtaatcagatcatgcgccgcctgcgccag
ctgatcgcacagtcctggcataccgatgaaatccgtaaaattcgtcctaccccggtagat
gaagccaaatggggctttgccgtggtggaaaacagcctgtgggaaggcgtgcctgcgttt
ttacgcgagctggatgaacagctggaacaggcttttggctaccgtctgcccgttgatgcg
gttccggtacgctttacgtcttggatgggcggcgaccgcgacggtaacccgaacgtcacg
gcggaagtcactcgccatgtgctgttactcagccgttggaaagcagccgatctgttcctg
cgtgatattcaggtgctggtttccgagctgtcgatgtccgaatgtacgccggagctgctg
gagctggccggcggcagcgaggtacaggaaccgtaccgcgccatcatgaagtcgctgcgt
tcgcagttgagcagtacgctgagctatctggaagcacgtctgacaggtgaagagcgtctg
cctcctaaagatctgctggttaccaacgaacaactttgggaaccgctccacgcctgctat
cagtcgctgaaaacctgcggcatgggcatcatcgccgatggtcgtctgctggatacgctg
cgtcgcgtgcgctgcttcggcgtgcctttggtacgcatcgatgtccgtcaggaaagtacc
cgccacaccgaagcactggccgaaattacccgctatctgggtctgggcgactacgaaagc
tggtcagagtcggataagcaagccttcctaatccgtgaactgagctctaagcgcccgctc
ctaccgcgctactgggagccgagtgcggataccaaagaggtgctggatacctgtcgtgtc
atcgccaaagcgccaatcggttcagtcgcagcctatgtcatttcaatggcacgcacacct
tccgacgtgctagccgttcacctgctgctcaaagaagcgggctgcccgtttgccttgccg
gtcgcgccgctgtttgaaacgctggacgacctgaacaacgccgatgatgtcatgaaacag
ttgctgagcatcgactggtatcgcggctttatccaaggcaaacagatggtcatgatcggc
tattccgactccgcgaaagacgcgggcgtgatggccgcttcctgggcgcaatatcgtgca
caggacgcactgatcaaaacctgtgagaaagcgggtatcgcactgacgctgttccacgga
cgcggcggttccatcggtcgcggtggcgcaccggctcatgctgcgctgttgtcacaaccg
ccgggtagcctgaaaggtggcctgcgcgtgacggaacaaggcgagatgatccgctttaag
tacggcctgccggaagtcaccatcagcagcctggcgctgtataccggtgcgattctggaa
gcaaacctgctgccgccgccggagccaaaacaggaatggcacgaggtgatggatgagctg
tcccgcgtgtcctgcgatatgtaccgtggctacgtgcgtgagaacccggatttcgttcct
tacttccgcgccgctacgccggaactggagctgggtaaactgccgctggggtcacgtccg
gccaagcgtcgtccgaacggcggtgtggaaagcctgcgtgctatcccgtggattttcgcc
tggacgcagaaccgtctgatgctgccagcgtggctgggtgcaggtgccgcgttgcagaaa
gtggtggatgacggtaagcaggaacagctggaagccatgtgtcgcgactggccgttcttc
tcgacgcgtatcggtatgctggagatggtgttcgccaaagccgacctgtggctggcggag
tattacgatcagcgtctggtagaagagaaactgtggccgttagggaaacagctgcgcgat
cagctggccgccgatatcaatgtcgtgctggcgatctccaacgacgatcacctgatggcg
gatctgccgtggatcgccgagtcgatcgcattgcgtaacgtctataccgatcctctgaac
gtgttgcaggccgagttgctgcatcgttcacgtcagcaggaaaaaccggatgccgatctg
gagctggcgctgatggtgacgatcgccggtgttgcagcgggtatgcgtaatacgggttaa

DBGET integrated database retrieval system